Recombinant Human MAT2B protein, His-tagged
| Cat.No. : | MAT2B-3526H |
| Product Overview : | Recombinant Human MAT2B protein(1-323 aa), fused to His tag, was expressed in E. coli. |
| Availability | October 03, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-323 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MPEMPEDMEQEEVNIPNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLGAQRPRNTQLDCSKLETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | MAT2B methionine adenosyltransferase II, beta [ Homo sapiens ] |
| Official Symbol | MAT2B |
| Synonyms | MAT2B; methionine adenosyltransferase II, beta; methionine adenosyltransferase 2 subunit beta; MATIIbeta; SDR23E1; short chain dehydrogenase/reductase family 23E; member 1; MAT II beta; putative protein product of Nbla02999; dTDP-4-keto-6-deoxy-D-glucose 4-reductase; putative dTDP-4-keto-6-deoxy-D-glucose 4-reductase; short chain dehydrogenase/reductase family 23E, member 1; beta regulatory subunit of methionine adenosyltransferase; TGR; MAT-II; Nbla02999; MGC12237; |
| Gene ID | 27430 |
| mRNA Refseq | NM_013283 |
| Protein Refseq | NP_037415 |
| MIM | 605527 |
| UniProt ID | Q9NZL9 |
| ◆ Recombinant Proteins | ||
| MAT2B-3252R | Recombinant Rat MAT2B Protein, His (Fc)-Avi-tagged | +Inquiry |
| MAT2B-2423H | Recombinant Human MAT2B Protein, His-tagged | +Inquiry |
| MAT2B-9585M | Recombinant Mouse MAT2B Protein | +Inquiry |
| MAT2B-2686R | Recombinant Rhesus monkey MAT2B Protein, His-tagged | +Inquiry |
| MAT2B-3596R | Recombinant Rat MAT2B Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MAT2B-4453HCL | Recombinant Human MAT2B 293 Cell Lysate | +Inquiry |
| MAT2B-4452HCL | Recombinant Human MAT2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAT2B Products
Required fields are marked with *
My Review for All MAT2B Products
Required fields are marked with *
