Recombinant Human MAT2B protein, His-tagged

Cat.No. : MAT2B-3526H
Product Overview : Recombinant Human MAT2B protein(1-323 aa), fused to His tag, was expressed in E. coli.
Availability June 13, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-323 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MPEMPEDMEQEEVNIPNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLGAQRPRNTQLDCSKLETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name MAT2B methionine adenosyltransferase II, beta [ Homo sapiens ]
Official Symbol MAT2B
Synonyms MAT2B; methionine adenosyltransferase II, beta; methionine adenosyltransferase 2 subunit beta; MATIIbeta; SDR23E1; short chain dehydrogenase/reductase family 23E; member 1; MAT II beta; putative protein product of Nbla02999; dTDP-4-keto-6-deoxy-D-glucose 4-reductase; putative dTDP-4-keto-6-deoxy-D-glucose 4-reductase; short chain dehydrogenase/reductase family 23E, member 1; beta regulatory subunit of methionine adenosyltransferase; TGR; MAT-II; Nbla02999; MGC12237;
Gene ID 27430
mRNA Refseq NM_013283
Protein Refseq NP_037415
MIM 605527
UniProt ID Q9NZL9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAT2B Products

Required fields are marked with *

My Review for All MAT2B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon