Recombinant Human MAT2B protein, His-tagged
Cat.No. : | MAT2B-3526H |
Product Overview : | Recombinant Human MAT2B protein(1-323 aa), fused to His tag, was expressed in E. coli. |
Availability | September 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-323 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MPEMPEDMEQEEVNIPNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLGAQRPRNTQLDCSKLETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MAT2B methionine adenosyltransferase II, beta [ Homo sapiens ] |
Official Symbol | MAT2B |
Synonyms | MAT2B; methionine adenosyltransferase II, beta; methionine adenosyltransferase 2 subunit beta; MATIIbeta; SDR23E1; short chain dehydrogenase/reductase family 23E; member 1; MAT II beta; putative protein product of Nbla02999; dTDP-4-keto-6-deoxy-D-glucose 4-reductase; putative dTDP-4-keto-6-deoxy-D-glucose 4-reductase; short chain dehydrogenase/reductase family 23E, member 1; beta regulatory subunit of methionine adenosyltransferase; TGR; MAT-II; Nbla02999; MGC12237; |
Gene ID | 27430 |
mRNA Refseq | NM_013283 |
Protein Refseq | NP_037415 |
MIM | 605527 |
UniProt ID | Q9NZL9 |
◆ Recombinant Proteins | ||
MAT2B-2686R | Recombinant Rhesus monkey MAT2B Protein, His-tagged | +Inquiry |
MAT2B-2155Z | Recombinant Zebrafish MAT2B | +Inquiry |
MAT2B-2506R | Recombinant Rhesus Macaque MAT2B Protein, His (Fc)-Avi-tagged | +Inquiry |
MAT2B-3526H | Recombinant Human MAT2B protein, His-tagged | +Inquiry |
MAT2B-2423H | Recombinant Human MAT2B Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAT2B-4452HCL | Recombinant Human MAT2B 293 Cell Lysate | +Inquiry |
MAT2B-4453HCL | Recombinant Human MAT2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAT2B Products
Required fields are marked with *
My Review for All MAT2B Products
Required fields are marked with *