Recombinant Human MATN1 protein(231-480 aa), C-His-tagged
Cat.No. : | MATN1-2694H |
Product Overview : | Recombinant Human MATN1 protein(P21941)(231-480 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 231-480 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | DHDCEQVCISSPGSYTCACHEGFTLNSDGKTCNVCSGGGGSSATDLVFLIDGSKSVRPENFELVKKFISQIVDTLDVSDKLAQVGLVQYSSSVRQEFPLGRFHTKKDIKAAVRNMSYMEKGTMTGAALKYLIDNSFTVSSGARPGAQKVGIVFTDGRSQDYINDAAKKAKDLGFKMFAVGVGNAVEDELREIASEPVAEHYFYTADFKTINQIGKKLQKKICVEEDPCACESLVKFQAKVEGLLQALTRK |
Gene Name | MATN1 matrilin 1, cartilage matrix protein [ Homo sapiens ] |
Official Symbol | MATN1 |
Synonyms | MATN1; matrilin 1, cartilage matrix protein; CMP, CRTM; cartilage matrix protein; CMP; CRTM; |
Gene ID | 4146 |
mRNA Refseq | NM_002379 |
Protein Refseq | NP_002370 |
MIM | 115437 |
UniProt ID | P21941 |
◆ Recombinant Proteins | ||
MATN1-5387M | Recombinant Mouse MATN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MATN1-2694H | Recombinant Human MATN1 protein(231-480 aa), C-His-tagged | +Inquiry |
MATN1-2241C | Recombinant Chicken MATN1 | +Inquiry |
MATN1-5783Z | Recombinant Zebrafish MATN1 | +Inquiry |
MATN1-9587M | Recombinant Mouse MATN1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MATN1 Products
Required fields are marked with *
My Review for All MATN1 Products
Required fields are marked with *