Recombinant Human MATN2 protein(841-950 aa), C-His-tagged
| Cat.No. : | MATN2-2456H |
| Product Overview : | Recombinant Human MATN2 protein(O00339)(841-950 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 841-950 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | SDGRQDSPAGELPKTVQQPTESEPVTINIQDLLSCSNFAVQHRYLFEEDNLLRSTQKLSHSTKPSGSPLEEKHDQCKCENLIMFQNLANEEVRKLTQRLEEMTQRMEALE |
| Gene Name | MATN2 matrilin 2 [ Homo sapiens ] |
| Official Symbol | MATN2 |
| Synonyms | MATN2; matrilin 2; matrilin-2; |
| Gene ID | 4147 |
| mRNA Refseq | NM_002380 |
| Protein Refseq | NP_002371 |
| MIM | 602108 |
| UniProt ID | O00339 |
| ◆ Recombinant Proteins | ||
| MATN2-3644H | Recombinant Human MATN2 protein, His-tagged | +Inquiry |
| Matn2-3971M | Recombinant Mouse Matn2 Protein, Myc/DDK-tagged | +Inquiry |
| MATN2-6611H | Recombinant Human MATN2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MATN2-3440H | Recombinant Human MATN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MATN2-3441H | Recombinant Human MATN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MATN2-4449HCL | Recombinant Human MATN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MATN2 Products
Required fields are marked with *
My Review for All MATN2 Products
Required fields are marked with *
