Species : |
Human |
Source : |
E.coli |
Tag : |
His&T7 |
Protein Length : |
29-486 a.a. |
Description : |
Human Matrillin-3 (MATN3) gene encodes a member of von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. MATN3 protein contains two von Willebrand factor A domains; it is present in the cartilage extracellular matrix and has a role in the development and homeostasis of cartilage and bone. Mutations in this gene result in multiple epiphyseal dysplasia. |
Form : |
0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : |
MASMTGGQQMGRGHHHHHHENLYFQGGEFGSDPVARPGFRRLETRGPGGSPGRRPSPAAPDGAPASGTSEPGRAR GAGVCKSRPLDLVFIIDSSRSVRPLEFTKVKTFVSRIIDTLDIGPADTRVAVVNYASTVKIEFQLQAYTDKQSLK QAVGRITPLSTGTMSGLAIQTAMDEAFTVEAGAREPSSNIPKVAIIVTDGRPQDQVNEVAARAQASGIELYAVGV DRADMASLKMMASEPLEEHVFYVETYGVIEKLSSRFQETFCALDPCVLGTHQCQHVCISDGEGKHHCECSQGYTL NADKKTCSALDRCALNTHGCEHICVNDRSGSYHCECYEGYTLNEDRKTCSAQDKCALGTHGCQHICVNDRTGSHH CECYEGYTLNADKKTCSVRDKCALGSHGCQHICVSDGAASYHCDCYPGYTLNEDKKTCSATEEARRLVSTEDACG CEATLAFQDKVSSYLQRLNTKLDDILEKLKINEYGQIHR |
Purity : |
>90% by SDS-PAGE |
Applications : |
1. May be used for in vitro MATN3 mediated osteoblast differentiation pathway regulation study for cartilage formation with this protein either as soluble factor or as coating matrix protein.2. May be used for protein-protein interaction mapping.3. Potential biomarker protein for clinical monitoring NK cell function in vitro.4. As immunogen for specific antibody production. |
Storage : |
Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |