"MATN3" Related Products

Expand

Recombinant Human MATN3 protein, T7/His-tagged

Cat.No.: MATN3-103H
Product Overview: Recombinant human Matrillin-3 cDNA (29 - 486aa, derived from BC139907) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Description: Human Matrillin-3 (MATN3) gene encodes a member of von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. MATN3 protein contains two von Willebrand factor A domains; it is present in the cartilage extracellular matrix and has a role in the development and homeostasis of cartilage and bone. Mutations in this gene result in multiple epiphyseal dysplasia.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFGSDPVARPGFRRLETRGPGGSPGRRPSPAAPDGAPASGTSEPGRAR GAGVCKSRPLDLVFIIDSSRSVRPLEFTKVKTFVSRIIDTLDIGPADTRVAVVNYASTVKIEFQLQAYTDKQSLK QAVGRITPLSTGTMSGLAIQTAMDEAFTVEAGAREPSSNIPKVAIIVTDGRPQDQVNEVAARAQASGIELYAVGV DRADMASLKMMASEPLEEHVFYVETYGVIEKLSSRFQETFCALDPCVLGTHQCQHVCISDGEGKHHCECSQGYTL NADKKTCSALDRCALNTHGCEHICVNDRSGSYHCECYEGYTLNEDRKTCSAQDKCALGTHGCQHICVNDRTGSHH CECYEGYTLNADKKTCSVRDKCALGSHGCQHICVSDGAASYHCDCYPGYTLNEDKKTCSATEEARRLVSTEDACG CEATLAFQDKVSSYLQRLNTKLDDILEKLKINEYGQIHR
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro MATN3 mediated osteoblast differentiation pathway regulation study for cartilage formation with this protein either as soluble factor or as coating matrix protein.2. May be used for protein-protein interaction mapping.3. Potential biomarker protein for clinical monitoring NK cell function in vitro.4. As immunogen for specific antibody production.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: MATN3 matrilin 3 [ Homo sapiens ]
Official Symbol: MATN3
Synonyms: MATN3; matrilin 3; matrilin-3; EDM5; HOA; OS2; DIPOA; OADIP;
Gene ID: 4148
mRNA Refseq: NM_002381
Protein Refseq: NP_002372
MIM: 602109
UniProt ID: O15232
Chromosome Location: 2p24-p23
Function: calcium ion binding; extracellular matrix structural constituent; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.