Recombinant Human matrix metallopeptidase 14 (membrane-inserted) Protein, His-tagged
Cat.No. : | MMP14-813H |
Product Overview : | Recombinant Human MMP14, Hemopexin Domain, His-tagged |
Availability | September 06, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 315-512 aa |
Description : | Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. However, the protein encoded by this gene is a member of the membrane-type MMP (MT-MMP) subfamily; each member of this subfamily contains a potential transmembrane domain suggesting that these proteins are expressed at the cell surface rather than secreted. This protein activates MMP2 protein, and this activity may be involved in tumor invasion. |
Tag : | C-His |
Molecular Mass : | 24 kDa |
AA Sequence : | GPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGVTHHHHHH |
Purity : | > 90 % by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.29 mg/mL by BCA |
Storage Buffer : | Sterile PBS, pH 7.4. |
Gene Name | MMP14 matrix metallopeptidase 14 (membrane-inserted) [Homo sapiens (human)] |
Official Symbol | MMP14 |
Synonyms | MMP14; matrix metallopeptidase 14 (membrane-inserted); matrix metalloproteinase 14 (membrane inserted); matrix metalloproteinase-14; membrane type 1 metalloprotease; MT1 MMP; membrane-type matrix metalloproteinase 1; membrane-type-1 matrix metalloproteinase; matrix metalloproteinase 14 (membrane-inserted); 1; MMP-14; MMP-X1; MT-MMP; MT1MMP; MTMMP1; MT1-MMP; MT-MMP 1 |
Gene ID | 4323 |
mRNA Refseq | NM_004995 |
Protein Refseq | NP_004986 |
MIM | 600754 |
UniProt ID | P50281 |
◆ Recombinant Proteins | ||
MMP14-1837H | Active Recombinant Human MMP14 protein | +Inquiry |
RFL2938MF | Recombinant Full Length Mouse Matrix Metalloproteinase-14(Mmp14) Protein, His-Tagged | +Inquiry |
Mmp14-9911M | Recombinant Mouse Mmp14 protein, His-tagged | +Inquiry |
MMP14-3233H | Recombinant Human MMP14 protein, His-SUMO-tagged | +Inquiry |
MMP14-571H | Recombinant Human MMP14 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP14-4279HCL | Recombinant Human MMP14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP14 Products
Required fields are marked with *
My Review for All MMP14 Products
Required fields are marked with *