Recombinant Human MAZ protein(311-440 aa), C-His-tagged

Cat.No. : MAZ-2792H
Product Overview : Recombinant Human MAZ protein(P56270)(311-440 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 311-440 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : VCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPDHLNSHVRQVHSTERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHVCELCNKGTGEVCPMAAAAAA
Gene Name MAZ MYC-associated zinc finger protein (purine-binding transcription factor) [ Homo sapiens ]
Official Symbol MAZ
Synonyms MAZ; MYC-associated zinc finger protein (purine-binding transcription factor); myc-associated zinc finger protein; Pur 1; ZF87; Zif87; ZNF801; MAZI; zinc finger protein 801; transcription factor Zif87; purine-binding transcription factor; serum amyloid A activating factor 1; serum amyloid A activating factor 2; zinc-finger protein, 87 kilodaltons; PUR1; Pur-1; SAF-1; SAF-2; SAF-3;
Gene ID 4150
mRNA Refseq NM_001042539
Protein Refseq NP_001036004
MIM 600999
UniProt ID P56270

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAZ Products

Required fields are marked with *

My Review for All MAZ Products

Required fields are marked with *

0
cart-icon
0
compare icon