Recombinant Human MAZ protein(311-440 aa), C-His-tagged
| Cat.No. : | MAZ-2792H |
| Product Overview : | Recombinant Human MAZ protein(P56270)(311-440 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 311-440 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | VCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPDHLNSHVRQVHSTERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHVCELCNKGTGEVCPMAAAAAA |
| Gene Name | MAZ MYC-associated zinc finger protein (purine-binding transcription factor) [ Homo sapiens ] |
| Official Symbol | MAZ |
| Synonyms | MAZ; MYC-associated zinc finger protein (purine-binding transcription factor); myc-associated zinc finger protein; Pur 1; ZF87; Zif87; ZNF801; MAZI; zinc finger protein 801; transcription factor Zif87; purine-binding transcription factor; serum amyloid A activating factor 1; serum amyloid A activating factor 2; zinc-finger protein, 87 kilodaltons; PUR1; Pur-1; SAF-1; SAF-2; SAF-3; |
| Gene ID | 4150 |
| mRNA Refseq | NM_001042539 |
| Protein Refseq | NP_001036004 |
| MIM | 600999 |
| UniProt ID | P56270 |
| ◆ Recombinant Proteins | ||
| MAZ-1376H | Recombinant Human MAZ Protein, His (Fc)-Avi-tagged | +Inquiry |
| Maz-3976M | Recombinant Mouse Maz Protein, Myc/DDK-tagged | +Inquiry |
| MAZ-326H | Recombinant Human MAZ protein, MYC/DDK-tagged | +Inquiry |
| MAZ-4634H | Recombinant Human MAZ protein, His-tagged | +Inquiry |
| MAZ-2792H | Recombinant Human MAZ protein(311-440 aa), C-His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAZ Products
Required fields are marked with *
My Review for All MAZ Products
Required fields are marked with *
