Recombinant Human MAZ protein, GST-tagged
Cat.No. : | MAZ-325H |
Product Overview : | Recombinant Human MAZ(332 a.a. - 440 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 332-440 a.a. |
Description : | The protein encoded by this gene is a member of the basic helix-loop-helix leucine zipper (bHLHZ) family of transcription factors. It is able to form homodimers and heterodimers with other family members, which include Mad, Mxi1 and Myc. Myc is an oncoprotein implicated in cell proliferation, differentiation and apoptosis. The homodimers and heterodimers compete for a common DNA target site (the E box) and rearrangement among these dimer forms provides a complex system of transcriptional regulation. Mutations of this gene have been reported to be associated with hereditary pheochromocytoma. A pseudogene of this gene is located on the long arm of chromosome 7. Alternative splicing results in multiple transcript variants. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.73 kDa |
AA Sequence : | YQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPDHLNSHVRQVHSTERPFKCEKCEAAFATKDRL RAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQ |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | MAX MYC associated factor X [ Homo sapiens ] |
Official Symbol | MAX |
Synonyms | MAX; MYC associated factor X; MAX protein; protein max; bHLHd4; bHLHd5; bHLHd6; bHLHd7; bHLHd8; helix-loop-helix zipper protein; class D basic helix-loop-helix protein 4; orf1; MGC10775; MGC11225; MGC18164; MGC34679; MGC36767; |
Gene ID | 4149 |
mRNA Refseq | NM_002382 |
Protein Refseq | NP_002373 |
MIM | 154950 |
UniProt ID | P61244 |
Chromosome Location | 14q23 |
Pathway | C-MYC pathway, organism-specific biosystem; Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Cyclin A:Cdk2-associated events at S phase entry, organism-specific biosystem; Cyclin E associated events during G1/S transition, organism-specific biosystem; G1/S Transition, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem; |
Function | protein binding; protein complex binding; protein heterodimerization activity; protein homodimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription coactivator activity; transcription cofactor activity; |
◆ Recombinant Proteins | ||
MAZ-325H | Recombinant Human MAZ protein, GST-tagged | +Inquiry |
MAZ-4634H | Recombinant Human MAZ protein, His-tagged | +Inquiry |
MAZ-326H | Recombinant Human MAZ protein, MYC/DDK-tagged | +Inquiry |
MAZ-327H | Recombinant Human MAZ protein, GST-tagged | +Inquiry |
Maz-3976M | Recombinant Mouse Maz Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAZ Products
Required fields are marked with *
My Review for All MAZ Products
Required fields are marked with *