Recombinant Human MAZ protein, GST-tagged

Cat.No. : MAZ-327H
Product Overview : Recombinant Human MAZ(1 - 198 aa) fused with GST tag at N-terminal was expressed in E. coli.
Availability May 21, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-198 a.a.
Description : The protein encoded by this gene is a member of the basic helix-loop-helix leucine zipper (bHLHZ) family of transcription factors. It is able to form homodimers and heterodimers with other family members, which include Mad, Mxi1 and Myc. Myc is an oncoprotein implicated in cell proliferation, differentiation and apoptosis. The homodimers and heterodimers compete for a common DNA target site (the E box) and rearrangement among these dimer forms provides a complex system of transcriptional regulation. Mutations of this gene have been reported to be associated with hereditary pheochromocytoma. A pseudogene of this gene is located on the long arm of chromosome 7. Alternative splicing results in multiple transcript variants.
Form : Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 100 mM GSH, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization.
AA Sequence : MVPLSLLSVPQLSGAGGGGGEAGAGGGAAAVAAGGVVTTTASGKRIRKNHACEMCGKAFRDVYHLNRHKLSHSDE KPYQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPDHLNSHVRQVHSTERPFKCEKCEAAFATKD RLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHVCELCNKG
Purity : > 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.Storage of Reconstituted Protein:Short-term storage: Store at 2-8 centigrade for two weeks.Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Gene Name MAX MYC associated factor X [ Homo sapiens ]
Official Symbol MAX
Synonyms MAX; MYC associated factor X; MAX protein; protein max; bHLHd4; bHLHd5; bHLHd6; bHLHd7; bHLHd8; helix-loop-helix zipper protein; class D basic helix-loop-helix protein 4; orf1; MGC10775; MGC11225; MGC18164; MGC34679; MGC36767;
Gene ID 4149
mRNA Refseq NM_002382
Protein Refseq NP_002373
MIM 154950
UniProt ID P61244
Chromosome Location 14q23
Pathway C-MYC pathway, organism-specific biosystem; Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Cyclin A:Cdk2-associated events at S phase entry, organism-specific biosystem; Cyclin E associated events during G1/S transition, organism-specific biosystem; G1/S Transition, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem;
Function protein binding; protein complex binding; protein heterodimerization activity; protein homodimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription coactivator activity; transcription cofactor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MAZ Products

Required fields are marked with *

My Review for All MAZ Products

Required fields are marked with *

0

Inquiry Basket

cartIcon