Recombinant Human MB protein

Species :	Human
Source :	E.coli
Tag :	Non
Protein Length :	153
Description :	This gene encodes a member of the globin superfamily and is expressed in skeletal and cardiac muscles. The encoded protein is a haemoprotein contributing to intracellular oxygen storage and transcellular facilitated diffusion of oxygen. At least three alternatively spliced transcript variants encoding the same protein have been reported.
Form :	Supplied as a 0.2μm filtered solution in 25 mM Tris-HCl, pH 8.0, with 50 % glycerol.
Molecular Mass :	Approximately 17.1 kDa, a single non-glycosylated polypeptide chain containing 153 amino acids.
AA Sequence :	GLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Endotoxin :	Less than 1.0 EU/μg of rHuMyoglobin as determined by LAL method.
Purity :	>95% by SDS-PAGE.
Storage :	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 6 months from date of receipt, -20 to -70 centigrade as supplied. 3 months, -20 to -70 centigrade under sterile conditions after opening.