Recombinant Human MBD2 protein(143-411aa), His-KSI-tagged

Cat.No. : MBD2-4938H
Product Overview : Recombinant Human MBD2 protein(Q9UBB5)(143-411aa), fused with N-terminal His and KSI tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&KSI
Protein Length : 143-411aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 45.2 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : ATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKPDLNTTLPIRQTASIFKQPVTKVTNHPSNKVKSDPQRMNEQPRQLFWEKRLQGLSASDVTEQIIKTMELPKGLQGVGPGSNDETLLSAVASALHTSSAPITGQVSAAVEKNPAVWLNTSQPLCKAFIVTDEDIRKQEERVQQVRKKLEEALMADILSRAADTEEMDIEMDSGDEA
Gene Name MBD2 methyl-CpG binding domain protein 2 [ Homo sapiens ]
Official Symbol MBD2
Synonyms MBD2; methyl-CpG binding domain protein 2; methyl-CpG-binding domain protein 2; demethylase; DMTase; NY-CO-41; DKFZp586O0821;
Gene ID 8932
mRNA Refseq NM_003927
Protein Refseq NP_003918
MIM 603547
UniProt ID Q9UBB5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MBD2 Products

Required fields are marked with *

My Review for All MBD2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon