Recombinant Human MBD2 protein(143-411aa), His-KSI-tagged
| Cat.No. : | MBD2-4938H |
| Product Overview : | Recombinant Human MBD2 protein(Q9UBB5)(143-411aa), fused with N-terminal His and KSI tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&KSI |
| Protein Length : | 143-411aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 45.2 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | ATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKPDLNTTLPIRQTASIFKQPVTKVTNHPSNKVKSDPQRMNEQPRQLFWEKRLQGLSASDVTEQIIKTMELPKGLQGVGPGSNDETLLSAVASALHTSSAPITGQVSAAVEKNPAVWLNTSQPLCKAFIVTDEDIRKQEERVQQVRKKLEEALMADILSRAADTEEMDIEMDSGDEA |
| Gene Name | MBD2 methyl-CpG binding domain protein 2 [ Homo sapiens ] |
| Official Symbol | MBD2 |
| Synonyms | MBD2; methyl-CpG binding domain protein 2; methyl-CpG-binding domain protein 2; demethylase; DMTase; NY-CO-41; DKFZp586O0821; |
| Gene ID | 8932 |
| mRNA Refseq | NM_003927 |
| Protein Refseq | NP_003918 |
| MIM | 603547 |
| UniProt ID | Q9UBB5 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MBD2 Products
Required fields are marked with *
My Review for All MBD2 Products
Required fields are marked with *




