Recombinant Human MBD3, His-tagged
| Cat.No. : | MBD3-28525TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 164-291 of Human MBD3 with N terminal His tag; Predicted MWt 15 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 164-291 a.a. |
| Description : | DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). However, unlike the other family members, MBD3 is not capable of binding to methylated DNA. The predicted MBD3 protein shares 71% and 94% identity with MBD2 (isoform 1) and mouse Mbd3.MBD3 is a subunit of the NuRD, a multisubunit complex containing nucleosome remodeling and histone deacetylase activities. MBD3 mediates the association of metastasis-associated protein 2 (MTA2) with the core histone deacetylase complex. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 86 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | GLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKN PGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLEE ALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEE EEPDPDPEMEHV |
| Sequence Similarities : | Contains 1 MBD (methyl-CpG-binding) domain. |
| Gene Name | MBD3 methyl-CpG binding domain protein 3 [ Homo sapiens ] |
| Official Symbol | MBD3 |
| Synonyms | MBD3; methyl-CpG binding domain protein 3; methyl-CpG-binding domain protein 3; |
| Gene ID | 53615 |
| mRNA Refseq | NM_003926 |
| Protein Refseq | NP_003917 |
| MIM | 603573 |
| Uniprot ID | O95983 |
| Chromosome Location | 19p13 |
| Pathway | Signaling events mediated by HDAC Class I, organism-specific biosystem; |
| Function | DNA binding; chromatin binding; protein binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MBD3 Products
Required fields are marked with *
My Review for All MBD3 Products
Required fields are marked with *



