Recombinant Human MBD3, His-tagged
Cat.No. : | MBD3-28525TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 164-291 of Human MBD3 with N terminal His tag; Predicted MWt 15 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 164-291 a.a. |
Description : | DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). However, unlike the other family members, MBD3 is not capable of binding to methylated DNA. The predicted MBD3 protein shares 71% and 94% identity with MBD2 (isoform 1) and mouse Mbd3.MBD3 is a subunit of the NuRD, a multisubunit complex containing nucleosome remodeling and histone deacetylase activities. MBD3 mediates the association of metastasis-associated protein 2 (MTA2) with the core histone deacetylase complex. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 86 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKN PGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLEE ALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEE EEPDPDPEMEHV |
Sequence Similarities : | Contains 1 MBD (methyl-CpG-binding) domain. |
Gene Name | MBD3 methyl-CpG binding domain protein 3 [ Homo sapiens ] |
Official Symbol | MBD3 |
Synonyms | MBD3; methyl-CpG binding domain protein 3; methyl-CpG-binding domain protein 3; |
Gene ID | 53615 |
mRNA Refseq | NM_003926 |
Protein Refseq | NP_003917 |
MIM | 603573 |
Uniprot ID | O95983 |
Chromosome Location | 19p13 |
Pathway | Signaling events mediated by HDAC Class I, organism-specific biosystem; |
Function | DNA binding; chromatin binding; protein binding; |
◆ Recombinant Proteins | ||
MBD3-2512R | Recombinant Rhesus Macaque MBD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
MBD3-3583C | Recombinant Chicken MBD3 | +Inquiry |
MBD3-7179H | Recombinant Human Methyl-CpG Binding Domain Protein 3, His-tagged | +Inquiry |
MBD3-28525TH | Recombinant Human MBD3, His-tagged | +Inquiry |
MBD3-2692R | Recombinant Rhesus monkey MBD3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MBD3-1065HCL | Recombinant Human MBD3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MBD3 Products
Required fields are marked with *
My Review for All MBD3 Products
Required fields are marked with *