"MBD4" Related Products

Recombinant Human MBD4 protein, T7/His-tagged

Cat.No.: MBD4-224H
Product Overview: Recombinant human MBD4 cDNA (580aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFGTTGLESLSLGDRGAAPTVTSSERLVPDPPNDLRKEDVAMELERVG EDEEQMMIKRSSECNPLLQEPIASAQFGATAGTECRKSVPCGWERVVKQRLFGKTAGRFDVYFISPQGLKFRSKS SLANYLHKNGETSLKPEDFDFTVLSKRGIKSRYKDCSMAALTSHLQNQSNNSNWNLRTRSKCKKDVFMPPSSSSE LQESRGLSNFTSTHLLLKEDEGVDDVNFRKVRKPKGKVTILKGIPIKKTKKGCRKSCSGFVQSDSKRESVCNKAD AESEPVAQKSQLDRTVCISDAGACGETLSVTSEENSLVKKKERSLSSGSNFCSEQKTSGIINKFCSAKDSEHNEK YEDTFLESEEIGTKVEVVERKEHLHTDILKRGSEMDNNCSPTRKDFTGEKIFQEDTIPRTQIERRKTSLYFSSKY NKEALSPPRRKAFKKWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWKFLEKYPSAEVARTADWR DVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHGIGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWE NHEKLSLS
Purity: >90% by SDS-PAGE
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: MBD4 methyl-CpG binding domain protein 4 [ Homo sapiens ]
Official Symbol: MBD4
Synonyms: MBD4; methyl-CpG binding domain protein 4; methyl-CpG-binding domain protein 4; MED1; G/T mismatch glycosylase; G/U mismatch glycosylase; methyl-CpG-binding protein MBD4; 3,N(4)-ethenocytosine glycosylase; methyl-CpG-binding endonuclease 1; mismatch-specific DNA N-glycosylase; putative methyl-CpG binding protein; G/5-fluorouracil mismatch glycosylase with biphasic kinetics;
Gene ID: 8930
mRNA Refseq: NM_003925
Protein Refseq: NP_003916
MIM: 603574
UniProt ID: O95243
Chromosome Location: 3q21.3
Pathway: Base Excision Repair, organism-specific biosystem; Base excision repair, organism-specific biosystem; Base excision repair, conserved biosystem; Base-Excision Repair, AP Site Formation, organism-specific biosystem; Base-free sugar-phosphate removal via the single-nucleotide replacement pathway, organism-specific biosystem; Cleavage of the damaged pyrimidine, organism-specific biosystem; DNA Repair, organism-specific biosystem;
Function: DNA binding; catalytic activity; endodeoxyribonuclease activity; hydrolase activity; protein binding; satellite DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.