Recombinant Human MBD4 protein, T7/His-tagged
Cat.No. : | MBD4-224H |
Product Overview : | Recombinant human MBD4 cDNA (580aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFGTTGLESLSLGDRGAAPTVTSSERLVPDPPNDLRKEDVAMELERVG EDEEQMMIKRSSECNPLLQEPIASAQFGATAGTECRKSVPCGWERVVKQRLFGKTAGRFDVYFISPQGLKFRSKS SLANYLHKNGETSLKPEDFDFTVLSKRGIKSRYKDCSMAALTSHLQNQSNNSNWNLRTRSKCKKDVFMPPSSSSE LQESRGLSNFTSTHLLLKEDEGVDDVNFRKVRKPKGKVTILKGIPIKKTKKGCRKSCSGFVQSDSKRESVCNKAD AESEPVAQKSQLDRTVCISDAGACGETLSVTSEENSLVKKKERSLSSGSNFCSEQKTSGIINKFCSAKDSEHNEK YEDTFLESEEIGTKVEVVERKEHLHTDILKRGSEMDNNCSPTRKDFTGEKIFQEDTIPRTQIERRKTSLYFSSKY NKEALSPPRRKAFKKWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWKFLEKYPSAEVARTADWR DVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHGIGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWE NHEKLSLS |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | MBD4 methyl-CpG binding domain protein 4 [ Homo sapiens ] |
Official Symbol | MBD4 |
Synonyms | MBD4; methyl-CpG binding domain protein 4; methyl-CpG-binding domain protein 4; MED1; G/T mismatch glycosylase; G/U mismatch glycosylase; methyl-CpG-binding protein MBD4; 3,N(4)-ethenocytosine glycosylase; methyl-CpG-binding endonuclease 1; mismatch-specific DNA N-glycosylase; putative methyl-CpG binding protein; G/5-fluorouracil mismatch glycosylase with biphasic kinetics; |
Gene ID | 8930 |
mRNA Refseq | NM_003925 |
Protein Refseq | NP_003916 |
MIM | 603574 |
UniProt ID | O95243 |
Chromosome Location | 3q21.3 |
Pathway | Base Excision Repair, organism-specific biosystem; Base excision repair, organism-specific biosystem; Base excision repair, conserved biosystem; Base-Excision Repair, AP Site Formation, organism-specific biosystem; Base-free sugar-phosphate removal via the single-nucleotide replacement pathway, organism-specific biosystem; Cleavage of the damaged pyrimidine, organism-specific biosystem; DNA Repair, organism-specific biosystem; |
Function | DNA binding; catalytic activity; endodeoxyribonuclease activity; hydrolase activity; protein binding; satellite DNA binding; |
◆ Recombinant Proteins | ||
MBD4-224H | Recombinant Human MBD4 protein, T7/His-tagged | +Inquiry |
MBD4-333H | Recombinant Human MBD4 Protein, His-tagged | +Inquiry |
MBD4-6259C | Recombinant Chicken MBD4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MBD4-403HCL | Recombinant Human MBD4 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MBD4 Products
Required fields are marked with *
My Review for All MBD4 Products
Required fields are marked with *