Recombinant Human MBNL1 protein, His-tagged
| Cat.No. : | MBNL1-6554H |
| Product Overview : | Recombinant Human MBNL1 protein(1-343 aa), fused with His tag, was expressed in E.coli. |
| Availability | January 16, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-343 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | MBNL1 muscleblind-like splicing regulator 1 [ Homo sapiens ] |
| Official Symbol | MBNL1 |
| Synonyms | MBNL1; muscleblind-like splicing regulator 1; MBNL, muscleblind (Drosophila) like , muscleblind like (Drosophila); muscleblind-like protein 1; EXP; EXP35; EXP40; EXP42; KIAA0428; triplet-expansion RNA-binding protein; MBNL; DKFZp686P06174; |
| Gene ID | 4154 |
| mRNA Refseq | NM_207293 |
| Protein Refseq | NP_997176 |
| MIM | 606516 |
| UniProt ID | Q9NR56 |
| ◆ Recombinant Proteins | ||
| MBNL1-2738H | Recombinant Human MBNL1, MYC/DDK-tagged | +Inquiry |
| Mbnl1-3982M | Recombinant Mouse Mbnl1 Protein, Myc/DDK-tagged | +Inquiry |
| MBNL1-2739H | Recombinant Human MBNL1, MYC/DDK-tagged | +Inquiry |
| MBNL1-6452H | Recombinant Human MBNL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MBNL1-2736H | Recombinant Human MBNL1, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MBNL1-4441HCL | Recombinant Human MBNL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MBNL1 Products
Required fields are marked with *
My Review for All MBNL1 Products
Required fields are marked with *
