"MBNL1" Related Products

Expand

Recombinant Human MBNL1 protein, His-tagged

Cat.No.: MBNL1-6554H
Product Overview: Recombinant Human MBNL1(1-343aa) fused with His tag at N-terminal was expressed in E. coli.
Description: MBNL1 played an important role in many functions.
Source: E. coli
Species: Human
Tag: His
Form: Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 300 mM Imidazole, pH8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilizaAon.
Molecular Mass: 43 kDa
Protein length: 1-343aa
AA Sequence: MGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAA AFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHP ADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMTQSAVKSLK RPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVVP MVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM
Stability: Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.Storage of Reconstituted Protein:Short-term storage: Store at 2-8 centigrade for two weeks.Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconsAtuAon. Avoid repeat freeze-thaw cycles.
Reconstitution: ReconsAtute at 0.25 µg/μl in 200 μl sterile water for short-term storage.ReconsAtuAon with 200 μl 50% glycerol soluAon is recommended for longer term storage (see Stability and Storage for more details).If a different concentraAon is needed for your purposes please adjust the reconsAtuAon volume as required (please note: the ion concentraAon of the final soluAon will vary according to the volume used).Note: Centrifuge vial before opening. When reconsAtuAng, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into soluAon.
Shipping: The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below).
Gene Name: MBNL1 muscleblind-like splicing regulator 1 [ Homo sapiens ]
Official Symbol: MBNL1
Synonyms: MBNL1; muscleblind-like splicing regulator 1; MBNL, muscleblind (Drosophila) like , muscleblind like (Drosophila); muscleblind-like protein 1; EXP; EXP35; EXP40; EXP42; KIAA0428; triplet-expansion RNA-binding protein; MBNL; DKFZp686P06174;
Gene ID: 4154
mRNA Refseq: NM_207293
Protein Refseq: NP_997176
MIM: 606516
UniProt ID: Q9NR56
Chromosome Location: 3q25
Pathway: Adipogenesis, organism-specific biosystem;
Function: RNA binding; double-stranded RNA binding; metal ion binding; nucleic acid binding; protein binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.