Recombinant Human MBNL1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MBNL1-660H |
Product Overview : | MBNL1 MS Standard C13 and N15-labeled recombinant protein (NP_066368) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the muscleblind protein family which was initially described in Drosophila melanogaster. The encoded protein is a C3H-type zinc finger protein that modulates alternative splicing of pre-mRNAs. Muscleblind proteins bind specifically to expanded dsCUG RNA but not to normal size CUG repeats and may thereby play a role in the pathophysiology of myotonic dystrophy. Mice lacking this gene exhibited muscle abnormalities and cataracts. Several alternatively spliced transcript variants have been described but the full-length natures of only some have been determined. The different isoforms are thought to have different binding specificities and/or splicing activities. |
Molecular Mass : | 41 kDa |
AA Sequence : | MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MBNL1 muscleblind-like splicing regulator 1 [ Homo sapiens (human) ] |
Official Symbol | MBNL1 |
Synonyms | MBNL1; muscleblind-like splicing regulator 1; MBNL, muscleblind (Drosophila) like, muscleblind like (Drosophila); muscleblind-like protein 1; EXP; EXP35; EXP40; EXP42; KIAA0428; triplet-expansion RNA-binding protein; MBNL; DKFZp686P06174; |
Gene ID | 4154 |
mRNA Refseq | NM_021038 |
Protein Refseq | NP_066368 |
MIM | 606516 |
UniProt ID | Q9NR56 |
◆ Recombinant Proteins | ||
MBNL1-4523Z | Recombinant Zebrafish MBNL1 | +Inquiry |
MBNL1-241H | Recombinant Human MBNL1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
MBNL1-2738H | Recombinant Human MBNL1, MYC/DDK-tagged | +Inquiry |
MBNL1-30258TH | Recombinant Human MBNL1 | +Inquiry |
MBNL1-3978C | Recombinant Chicken MBNL1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MBNL1-4441HCL | Recombinant Human MBNL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MBNL1 Products
Required fields are marked with *
My Review for All MBNL1 Products
Required fields are marked with *
0
Inquiry Basket