Recombinant Human MBNL3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MBNL3-5406H |
Product Overview : | MBNL3 MS Standard C13 and N15-labeled recombinant protein (NP_060858) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the muscleblind-like family of proteins. The encoded protein may function in regulation of alternative splicing and may play a role in the pathophysiology of myotonic dystrophy. Alternatively spliced transcript variants have been described. |
Molecular Mass : | 38.4 kDa |
AA Sequence : | MTAVNVALIRDTKWLTLEVCREFQRGTCSRADADCKFAHPPRVCHVENGRVVACFDSLKGRCTRENCKYLHPPPHLKTQLEINGRNNLIQQKTAAAMFAQQMQLMLQNAQMSSLGSFPMTPSIPANPPMAFNPYIPHPGMGLVPAELVPNTPVLIPGNPPLAMPGAVGPKLMRSDKLEVCREFQRGNCTRGENDCRYAHPTDASMIEASDNTVTICMDYIKGRCSREKCKYFHPPAHLQARLKAAHHQMNHSAASAMALQPGTLQLIPKRSALEKPNGATPVFNPTVFHCQQALTNLQLPQPAFIPAGPILCMAPASNIVPMMHGATPTTVSAATTPATSVPFAAPTTGNQLKFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MBNL3 muscleblind-like splicing regulator 3 [ Homo sapiens (human) ] |
Official Symbol | MBNL3 |
Synonyms | MBNL3; muscleblind-like splicing regulator 3; muscleblind like 3 (Drosophila); muscleblind-like protein 3; CHCR; FLJ11316; MBLX39; MBXL; muscleblind-like 3; Cys3His CCG1-required protein; muscleblind-like X-linked protein; MBLX; FLJ97142; |
Gene ID | 55796 |
mRNA Refseq | NM_018388 |
Protein Refseq | NP_060858 |
MIM | 300413 |
UniProt ID | Q9NUK0 |
◆ Recombinant Proteins | ||
MBNL3-1945C | Recombinant Chicken MBNL3 | +Inquiry |
MBNL3-3982C | Recombinant Chicken MBNL3 | +Inquiry |
MBNL3-5211H | Recombinant Human MBNL3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Mbnl3-3983M | Recombinant Mouse Mbnl3 Protein, Myc/DDK-tagged | +Inquiry |
MBNL3-3983C | Recombinant Chicken MBNL3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MBNL3-1067HCL | Recombinant Human MBNL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MBNL3 Products
Required fields are marked with *
My Review for All MBNL3 Products
Required fields are marked with *