Recombinant Human MBTPS1 protein, His-tagged
Cat.No. : | MBTPS1-2960H |
Product Overview : | Recombinant Human MBTPS1 protein(187-400 aa), fused to His tag, was expressed in E. coli. |
Availability | September 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 187-400 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | RAIPRQVAQTLQADVLWQMGYTGANVRVAVFDTGLSEKHPHFKNVKERTNWTNERTLDDGLGHGTFVAGVIASMRECQGFAPDAELHIFRVFTNNQVSYTSWFLDAFNYAILKKIDVLNLSIGGPDFMDHPFVDKVWELTANNVIMVSAIGNDGPLYGTLNNPADQMDVIGVGGIDFEDNIARFSSRGMTTWELPGGYGRMKPDIVTYGAGVRG |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MBTPS1 membrane-bound transcription factor peptidase, site 1 [ Homo sapiens ] |
Official Symbol | MBTPS1 |
Synonyms | MBTPS1; membrane-bound transcription factor peptidase, site 1; membrane bound transcription factor protease, site 1; membrane-bound transcription factor site-1 protease; KIAA0091; PCSK8; S1P; SKI 1; site-1 protease; endopeptidase S1P; subtilisin/kexin isozyme-1; subtilisin/kexin-isozyme 1; membrane-bound transcription factor protease, site 1; SKI-1; MGC138711; MGC138712; |
Gene ID | 8720 |
mRNA Refseq | NM_003791 |
Protein Refseq | NP_003782 |
MIM | 603355 |
UniProt ID | Q14703 |
◆ Recombinant Proteins | ||
MBTPS1-3608R | Recombinant Rat MBTPS1 Protein | +Inquiry |
MBTPS1-9897Z | Recombinant Zebrafish MBTPS1 | +Inquiry |
MBTPS1-29H | Recombinant Human MBTPS1 protein, GST-tagged | +Inquiry |
MBTPS1-138H | Recombinant Human MBTPS1, His-tagged | +Inquiry |
MBTPS1-5400M | Recombinant Mouse MBTPS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MBTPS1-4435HCL | Recombinant Human MBTPS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MBTPS1 Products
Required fields are marked with *
My Review for All MBTPS1 Products
Required fields are marked with *