Recombinant Human MCHR1 Protein, GST-tagged
Cat.No. : | MCHR1-5224H |
Product Overview : | Human GPR24 full-length ORF ( AAH01736, 1 a.a. - 422 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene, a member of the G protein-coupled receptor family 1, is an integral plasma membrane protein which binds melanin-concentrating hormone. The encoded protein can inhibit cAMP accumulation and stimulate intracellular calcium flux, and is probably involved in the neuronal regulation of food consumption. Although structurally similar to somatostatin receptors, this protein does not seem to bind somatostatin. [provided by RefSeq |
Molecular Mass : | 71.94 kDa |
AA Sequence : | MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPDCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQLTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTLVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MCHR1 melanin-concentrating hormone receptor 1 [ Homo sapiens ] |
Official Symbol | MCHR1 |
Synonyms | MCHR1; melanin-concentrating hormone receptor 1; G protein coupled receptor 24, GPR24; MCH1R; SLC1; SLC-1; MCH-1R; MCH receptor 1; G protein-coupled receptor 24; somatostatin receptor-like protein; GPR24; MGC32129; |
Gene ID | 2847 |
mRNA Refseq | NM_005297 |
Protein Refseq | NP_005288 |
MIM | 601751 |
UniProt ID | Q99705 |
◆ Recombinant Proteins | ||
MCHR1-5224H | Recombinant Human MCHR1 Protein, GST-tagged | +Inquiry |
RFL24904MF | Recombinant Full Length Mouse Melanin-Concentrating Hormone Receptor 1(Mchr1) Protein, His-Tagged | +Inquiry |
RFL25335RF | Recombinant Full Length Rat Melanin-Concentrating Hormone Receptor 1(Mchr1) Protein, His-Tagged | +Inquiry |
MCHR1-3617R | Recombinant Rat MCHR1 Protein | +Inquiry |
MCHR1-2700R | Recombinant Rhesus monkey MCHR1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MCHR1-4424HCL | Recombinant Human MCHR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MCHR1 Products
Required fields are marked with *
My Review for All MCHR1 Products
Required fields are marked with *
0
Inquiry Basket