Recombinant Human MCHR1 Protein, GST-tagged

• Cat.No.: MCHR1-5224H
• Product Overview: Human GPR24 full-length ORF ( AAH01736, 1 a.a. - 422 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene, a member of the G protein-coupled receptor family 1, is an integral plasma membrane protein which binds melanin-concentrating hormone. The encoded protein can inhibit cAMP accumulation and stimulate intracellular calcium flux, and is probably involved in the neuronal regulation of food consumption. Although structurally similar to somatostatin receptors, this protein does not seem to bind somatostatin. [provided by RefSeq
• Molecular Mass: 71.94 kDa
• AA Sequence: MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPDCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQLTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTLVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MCHR1 melanin-concentrating hormone receptor 1 [ Homo sapiens ]
• Official Symbol: MCHR1
• Synonyms: MCHR1; melanin-concentrating hormone receptor 1; G protein coupled receptor 24, GPR24; MCH1R; SLC1; SLC-1; MCH-1R; MCH receptor 1; G protein-coupled receptor 24; somatostatin receptor-like protein; GPR24; MGC32129
• Gene ID: 2847
• mRNA Refseq: NM_005297
• Protein Refseq: NP_005288
• MIM: 601751
• UniProt ID: Q99705