Recombinant Human MCM2, His-tagged
Cat.No. : | MCM2-28039TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 370-904 of Human MCM2 with N terminal His tag; 535 amino acids, 65kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 370-904 a.a. |
Description : | The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein forms a complex with MCM4, 6, and 7, and has been shown to regulate the helicase activity of the complex. This protein is phosphorylated, and thus regulated by, protein kinases CDC2 and CDC7. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 108 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | YQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPG DEIELTGIYHNNYDGSLNTANGFPVFATVILANHVAKK DNKVAVGELTDEDVKMITSLSKDQQIGEKIFASIAPSIYG HEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDP GTAKSQFLKYIEKVSSRAIFTTGQGASAVGLTAYVQRH PVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEA MEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSL TFSENVDLTEPIISRFDILCVVRDTVDPVQDEMLARFV VGSHVRHHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEV LKKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMAT GSIPITVRHIESMIRMAEAHARIHLRDYVIEDDVNMAI RVMLESFIDTQKFSVMRSMRKTFARYLSFRRDNNELLLFI LKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQIN IHNLSAFYDSELFRMNKFSHDLKRKMILQQF |
Sequence Similarities : | Belongs to the MCM family.Contains 1 MCM domain. |
Gene Name | MCM2 minichromosome maintenance complex component 2 [ Homo sapiens ] |
Official Symbol | MCM2 |
Synonyms | MCM2; minichromosome maintenance complex component 2; CCNL1, CDCL1, MCM2 minichromosome maintenance deficient 2, mitotin (S. cerevisiae) , minichromosome maintenance deficient (S. cerevisiae) 2 (mitotin); DNA replication licensing factor MCM2; BM28; cdc |
Gene ID | 4171 |
mRNA Refseq | NM_004526 |
Protein Refseq | NP_004517 |
MIM | 116945 |
Uniprot ID | P49736 |
Chromosome Location | 3q21 |
Pathway | Activation of ATR in response to replication stress, organism-specific biosystem; Activation of the pre-replicative complex, organism-specific biosystem; Assembly of the pre-replicative complex, organism-specific biosystem; Cell Cycle Checkpoints, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; |
Function | ATP binding; DNA binding; DNA replication origin binding; helicase activity; histone binding; |
◆ Recombinant Proteins | ||
MCM2-5410M | Recombinant Mouse MCM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MCM2-1291C | Recombinant Chicken MCM2 | +Inquiry |
MCM2-9530Z | Recombinant Zebrafish MCM2 | +Inquiry |
MCM2-9634M | Recombinant Mouse MCM2 Protein | +Inquiry |
MCM2-3212H | Recombinant Human MCM2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MCM2-4420HCL | Recombinant Human MCM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MCM2 Products
Required fields are marked with *
My Review for All MCM2 Products
Required fields are marked with *