Species : |
Human |
Source : |
E.coli |
Tag : |
His |
Description : |
Enables cytokine activity and growth factor activity. Acts upstream of or within several processes, including animal organ development; generation of neurons; and positive regulation of macromolecule metabolic process. Located in extracellular space. Is expressed in several structures, including alimentary system; central nervous system; cranium; early conceptus; and female reproductive system. Orthologous to human LIF (LIF interleukin 6 family cytokine). |
Molecular Mass : |
64.4 KD |
AA Sequence : |
MIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPVITELEHHHHHH |
Purity : |
> 95% by SDS-PAGE |
Usage : |
Protein binding assay, small molecule inhibitor screening, substrate of kinase, antigen, ELISA, Western blot, crystallization and co- crystallization studies. |
Storage : |
Upon delivery aliquot and store at -80 centigrade. Avoid multiple freeze-thaw cycles. The protein is stable for 12 months at -80 centigrade, for 2-4 weeks at 4 centigrade. |
Storage Buffer : |
30 mM Tris pH 7.4; 500 mM NaCl; 10% glycerol; 3 mM MgCl2; 5 mM beta-mercaptoethanol; 1 mM PMSF; 1 mM Benzamidine |
Reconstitution : |
Clear solution in 30 mM Tris, pH7.4, 150 mM NaCl, 40% Glycerol, 5 mM DTT |