Recombinant Human ME2 Protein, C-6×His tagged
Cat.No. : | ME2-19H |
Product Overview : | Recombinant Human ME2 Protein with C-6×His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Enables cytokine activity and growth factor activity. Acts upstream of or within several processes, including animal organ development; generation of neurons; and positive regulation of macromolecule metabolic process. Located in extracellular space. Is expressed in several structures, including alimentary system; central nervous system; cranium; early conceptus; and female reproductive system. Orthologous to human LIF (LIF interleukin 6 family cytokine). |
Molecular Mass : | 64.4 KD |
AA Sequence : | MIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPVITELEHHHHHH |
Purity : | > 95% by SDS-PAGE |
Usage : | Protein binding assay, small molecule inhibitor screening, substrate of kinase, antigen, ELISA, Western blot, crystallization and co- crystallization studies. |
Storage : | Upon delivery aliquot and store at -80 centigrade. Avoid multiple freeze-thaw cycles. The protein is stable for 12 months at -80 centigrade, for 2-4 weeks at 4 centigrade. |
Storage Buffer : | 30 mM Tris pH 7.4; 500 mM NaCl; 10% glycerol; 3 mM MgCl2; 5 mM beta-mercaptoethanol; 1 mM PMSF; 1 mM Benzamidine |
Reconstitution : | Clear solution in 30 mM Tris, pH7.4, 150 mM NaCl, 40% Glycerol, 5 mM DTT |
Gene Name | ME2 malic enzyme 2, NAD(+)-dependent, mitochondrial [ Homo sapiens (human) ] |
Official Symbol | ME2 |
Synonyms | ME2; malic enzyme 2, NAD(+)-dependent, mitochondrial; NAD-dependent malic enzyme, mitochondrial; NAD-ME; malate dehydrogenase; pyruvic-malic carboxylase; ODS1; |
Gene ID | 4200 |
mRNA Refseq | NM_001168335 |
Protein Refseq | NP_001161807 |
MIM | 154270 |
UniProt ID | P23368 |
◆ Recombinant Proteins | ||
ME2-5218H | Recombinant Human ME2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ME2-198HFL | Recombinant Full Length Human ME2 Protein, C-Flag-tagged | +Inquiry |
ME2-4488H | Recombinant Human ME2 Protein, GST-tagged | +Inquiry |
Me2-319M | Recombinant Mouse Me2 Protein, MYC/DDK-tagged | +Inquiry |
ME2-1545H | Recombinant Human ME2 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ME2-4400HCL | Recombinant Human ME2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ME2 Products
Required fields are marked with *
My Review for All ME2 Products
Required fields are marked with *
0
Inquiry Basket