Recombinant Human MECP2 Protein, His-tagged

Cat.No. : MECP2-1549H
Product Overview : Recombinant Human MECP2 (Met1-Ser486) was produced in HEK293 cells with C-terminal His tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 1-486 a.a.
Description : The MeCP2 helps regulate gene activity (expression) by modifying chromatin, the complex of DNA and protein that packages DNA into chromosomes. The MeCP2 protein is present in cells throughout the body, although it is particularly abundant in brain cells.In the brain, the MeCP2 protein likely plays a role in maintaining connections (synapses) between neurons, where cell-to-cell communication occurs. The alternative splicing of proteins is critical for normal communication between neurons and may also be necessary for the function of other types of brain cells.
Form : Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,pH 8.0.
AA Sequence : MVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAEAGKAETS EGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGK AFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSG TTRPKAATSEGVQVKRVLEKSPGKLLVKMPFQTSPGGKAEGGGATTSTQVMVIKRPGRKRKAEAD PQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVQETVLPIKKRKTRETVSIEVKEVVKPLLV STLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASSPPKKEHHHHHHHSESPKAPVPLLPPLPPPP PEPESSEDPTSPPEPQDLSSSVCKEEKMPRGGSLESDGCPKEPAKTQPAVATAATAAEKYKHRGE GERKDIVSSSMPRPNREEPVDSRTPVTERVSVDHHHHHH
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name MECP2 methyl CpG binding protein 2 (Rett syndrome) [ Homo sapiens ]
Official Symbol MECP2
Synonyms MECP2; methyl CpG binding protein 2 (Rett syndrome); mental retardation, X linked 16 , mental retardation, X linked 79 , MRX16, MRX79, RTT; methyl-CpG-binding protein 2; meCp-2 protein; RS; RTS; RTT; PPMX; MRX16; MRX79; MRXSL; AUTSX3; MRXS13; DKFZp686A24160;
Gene ID 4204
mRNA Refseq NM_001110792
Protein Refseq NP_001104262
MIM 300005
UniProt ID P51608

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MECP2 Products

Required fields are marked with *

My Review for All MECP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon