Recombinant Human MECP2 Protein, His-tagged
| Cat.No. : | MECP2-1549H |
| Product Overview : | Recombinant Human MECP2 (Met1-Ser486) was produced in HEK293 cells with C-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 1-486 a.a. |
| Description : | The MeCP2 helps regulate gene activity (expression) by modifying chromatin, the complex of DNA and protein that packages DNA into chromosomes. The MeCP2 protein is present in cells throughout the body, although it is particularly abundant in brain cells.In the brain, the MeCP2 protein likely plays a role in maintaining connections (synapses) between neurons, where cell-to-cell communication occurs. The alternative splicing of proteins is critical for normal communication between neurons and may also be necessary for the function of other types of brain cells. |
| Form : | Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,pH 8.0. |
| AA Sequence : | MVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAEAGKAETS EGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGK AFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSG TTRPKAATSEGVQVKRVLEKSPGKLLVKMPFQTSPGGKAEGGGATTSTQVMVIKRPGRKRKAEAD PQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVQETVLPIKKRKTRETVSIEVKEVVKPLLV STLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASSPPKKEHHHHHHHSESPKAPVPLLPPLPPPP PEPESSEDPTSPPEPQDLSSSVCKEEKMPRGGSLESDGCPKEPAKTQPAVATAATAAEKYKHRGE GERKDIVSSSMPRPNREEPVDSRTPVTERVSVDHHHHHH |
| Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
| Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
| Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Gene Name | MECP2 methyl CpG binding protein 2 (Rett syndrome) [ Homo sapiens ] |
| Official Symbol | MECP2 |
| Synonyms | MECP2; methyl CpG binding protein 2 (Rett syndrome); mental retardation, X linked 16 , mental retardation, X linked 79 , MRX16, MRX79, RTT; methyl-CpG-binding protein 2; meCp-2 protein; RS; RTS; RTT; PPMX; MRX16; MRX79; MRXSL; AUTSX3; MRXS13; DKFZp686A24160; |
| Gene ID | 4204 |
| mRNA Refseq | NM_001110792 |
| Protein Refseq | NP_001104262 |
| MIM | 300005 |
| UniProt ID | P51608 |
| ◆ Recombinant Proteins | ||
| MECP2-682C | Recombinant Cynomolgus MECP2 Protein, His-tagged | +Inquiry |
| MECP2-334H | Recombinant Human MECP2 Protein, His-tagged | +Inquiry |
| MECP2-9677M | Recombinant Mouse MECP2 Protein | +Inquiry |
| MECP2-2714R | Recombinant Rhesus monkey MECP2 Protein, His-tagged | +Inquiry |
| MECP2-2534R | Recombinant Rhesus Macaque MECP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MECP2-4395HCL | Recombinant Human MECP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MECP2 Products
Required fields are marked with *
My Review for All MECP2 Products
Required fields are marked with *
