Recombinant Human MECR protein, GST-tagged
Cat.No. : | MECR-1824H |
Product Overview : | Recombinant Human MECR protein(1-373 aa), fused to GST tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-373 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MWVCSTLWRVRTPARQWRGLLPASGCHGPAASSYSASAEPARVRALVYGHHGDPAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGLLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MECR mitochondrial trans-2-enoyl-CoA reductase [ Homo sapiens ] |
Official Symbol | MECR |
Synonyms | MECR; mitochondrial trans-2-enoyl-CoA reductase; trans-2-enoyl-CoA reductase, mitochondrial; CGI 63; FASN2B; mitochondrial 2 enoyl thioester reductase; NRBF1; nuclear receptor binding factor 1; NRBF-1; hsNrbf-1; nuclear receptor-binding factor 1; mitochondrial 2-enoyl thioester reductase; homolog of yeast 2-enoyl thioester reductase; CGI-63; |
Gene ID | 51102 |
mRNA Refseq | NM_001024732 |
Protein Refseq | NP_001019903 |
MIM | 608205 |
UniProt ID | Q9BV79 |
◆ Recombinant Proteins | ||
MECR-1825H | Recombinant Human MECR protein, GST-tagged | +Inquiry |
MECR-4482H | Recombinant Human MECR Protein, GST-tagged | +Inquiry |
MECR-6129HF | Recombinant Full Length Human MECR Protein, GST-tagged | +Inquiry |
MECR-3290R | Recombinant Rat MECR Protein, His (Fc)-Avi-tagged | +Inquiry |
MECR-27385TH | Recombinant Human MECR, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MECR-4394HCL | Recombinant Human MECR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MECR Products
Required fields are marked with *
My Review for All MECR Products
Required fields are marked with *