Recombinant Human MED1 protein, His-SUMO-tagged

Cat.No. : MED1-4421H
Product Overview : Recombinant Human MED1 protein(Q15648)(878-1031aa), fused to N-terminal His-SUMO tag, was expressed in E. coli
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 878-1031aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 32.2 kDa
AA Sequence : FGEEYFDESSQSGDNDDFKGFASQALNTLGVPMLGGDNGETKFKGNNQADTVDFSIISVAGKALAPADLMEHHSGSQGPLLTTGDLGKEKTQKRVKEGNGTSNSTLSGPGLDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGKSPSHSSSNRPF
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name MED1 mediator complex subunit 1 [ Homo sapiens ]
Official Symbol MED1
Synonyms MED1; mediator complex subunit 1; PPAR binding protein , PPARBP, PPARGBP, TRIP2; mediator of RNA polymerase II transcription subunit 1; CRSP1; CRSP200; DRIP230; PBP; RB18A; TRAP220; ARC205; TRIP-2; PPAR binding protein; PPAR-binding protein; PPARG binding protein; TR-interacting protein 2; p53 regulatory protein RB18A; thyroid receptor interacting protein 2; thyroid receptor-interacting protein 2; vitamin D receptor-interacting protein 230 kD; activator-recruited cofactor 205 kDa component; peroxisome proliferator-activated receptor-binding protein; vitamin D receptor-interacting protein complex component DRIP205; thyroid hormone receptor-associated protein complex 220 kDa component; thyroid hormone receptor-associated protein complex component TRAP220; TRIP2; PPARBP; DRIP205; PPARGBP; MGC71488;
Gene ID 5469
mRNA Refseq NM_004774
Protein Refseq NP_004765
MIM 604311
UniProt ID Q15648

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MED1 Products

Required fields are marked with *

My Review for All MED1 Products

Required fields are marked with *

0
cart-icon