Recombinant Human MED1 protein, His-SUMO-tagged

• Cat.No.: MED1-4421H
• Product Overview: Recombinant Human MED1 protein(Q15648)(878-1031aa), fused to N-terminal His-SUMO tag, was expressed in E. coli

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 878-1031aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 32.2 kDa
• AA Sequence: FGEEYFDESSQSGDNDDFKGFASQALNTLGVPMLGGDNGETKFKGNNQADTVDFSIISVAGKALAPADLMEHHSGSQGPLLTTGDLGKEKTQKRVKEGNGTSNSTLSGPGLDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGKSPSHSSSNRPF
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: MED1 mediator complex subunit 1 [ Homo sapiens ]
• Official Symbol: MED1
• Synonyms: MED1; mediator complex subunit 1; PPAR binding protein , PPARBP, PPARGBP, TRIP2; mediator of RNA polymerase II transcription subunit 1; CRSP1; CRSP200; DRIP230; PBP; RB18A; TRAP220; ARC205; TRIP-2; PPAR binding protein; PPAR-binding protein; PPARG binding protein; TR-interacting protein 2; p53 regulatory protein RB18A; thyroid receptor interacting protein 2; thyroid receptor-interacting protein 2; vitamin D receptor-interacting protein 230 kD; activator-recruited cofactor 205 kDa component; peroxisome proliferator-activated receptor-binding protein; vitamin D receptor-interacting protein complex component DRIP205; thyroid hormone receptor-associated protein complex 220 kDa component; thyroid hormone receptor-associated protein complex component TRAP220; TRIP2; PPARBP; DRIP205; PPARGBP; MGC71488
• Gene ID: 5469
• mRNA Refseq: NM_004774
• Protein Refseq: NP_004765
• MIM: 604311
• UniProt ID: Q15648