Recombinant Human MED1 protein, His-SUMO-tagged
Cat.No. : | MED1-4421H |
Product Overview : | Recombinant Human MED1 protein(Q15648)(878-1031aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 878-1031aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.2 kDa |
AA Sequence : | FGEEYFDESSQSGDNDDFKGFASQALNTLGVPMLGGDNGETKFKGNNQADTVDFSIISVAGKALAPADLMEHHSGSQGPLLTTGDLGKEKTQKRVKEGNGTSNSTLSGPGLDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGKSPSHSSSNRPF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | MED1 mediator complex subunit 1 [ Homo sapiens ] |
Official Symbol | MED1 |
Synonyms | MED1; mediator complex subunit 1; PPAR binding protein , PPARBP, PPARGBP, TRIP2; mediator of RNA polymerase II transcription subunit 1; CRSP1; CRSP200; DRIP230; PBP; RB18A; TRAP220; ARC205; TRIP-2; PPAR binding protein; PPAR-binding protein; PPARG binding protein; TR-interacting protein 2; p53 regulatory protein RB18A; thyroid receptor interacting protein 2; thyroid receptor-interacting protein 2; vitamin D receptor-interacting protein 230 kD; activator-recruited cofactor 205 kDa component; peroxisome proliferator-activated receptor-binding protein; vitamin D receptor-interacting protein complex component DRIP205; thyroid hormone receptor-associated protein complex 220 kDa component; thyroid hormone receptor-associated protein complex component TRAP220; TRIP2; PPARBP; DRIP205; PPARGBP; MGC71488; |
Gene ID | 5469 |
mRNA Refseq | NM_004774 |
Protein Refseq | NP_004765 |
MIM | 604311 |
UniProt ID | Q15648 |
◆ Recombinant Proteins | ||
MED1-800H | Recombinant Human MED1, GST-tagged | +Inquiry |
MED1-5440M | Recombinant Mouse MED1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MED1-01H | Recombiant Human MED1 Protein Lysate | +Inquiry |
MED1-9679M | Recombinant Mouse MED1 Protein | +Inquiry |
MED1-4421H | Recombinant Human MED1 protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MED1 Products
Required fields are marked with *
My Review for All MED1 Products
Required fields are marked with *
0
Inquiry Basket