Recombinant Human MED22 protein, GST-tagged
Cat.No. : | MED22-808H |
Product Overview : | Recombinant Human MED22 protein(1-140 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | July 29, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 1-140 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLRDEISIDLYELEEEYYSSRYK |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | MED22 mediator complex subunit 22 [ Homo sapiens ] |
Official Symbol | MED22 |
Synonyms | MED22; mediator complex subunit 22; SURF5, surfeit 5; mediator of RNA polymerase II transcription subunit 22; Med24; surfeit 5; surfeit locus protein 5; MED24; SURF5; surf-5; MGC48682; |
mRNA Refseq | NM_133640 |
Protein Refseq | NP_598395 |
MIM | 185641 |
UniProt ID | Q15528 |
Gene ID | 6837 |
◆ Recombinant Proteins | ||
MED22-5451M | Recombinant Mouse MED22 Protein, His (Fc)-Avi-tagged | +Inquiry |
MED22-3636R | Recombinant Rat MED22 Protein | +Inquiry |
MED22-3490C | Recombinant Chicken MED22 | +Inquiry |
MED22-2541R | Recombinant Rhesus Macaque MED22 Protein, His (Fc)-Avi-tagged | +Inquiry |
MED22-808H | Recombinant Human MED22 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MED22-4387HCL | Recombinant Human MED22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MED22 Products
Required fields are marked with *
My Review for All MED22 Products
Required fields are marked with *