Recombinant Human MED22 protein, GST-tagged
| Cat.No. : | MED22-808H |
| Product Overview : | Recombinant Human MED22 protein(1-140 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | January 23, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | GST |
| Protein Length : | 1-140 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLRDEISIDLYELEEEYYSSRYK |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | MED22 mediator complex subunit 22 [ Homo sapiens ] |
| Official Symbol | MED22 |
| Synonyms | MED22; mediator complex subunit 22; SURF5, surfeit 5; mediator of RNA polymerase II transcription subunit 22; Med24; surfeit 5; surfeit locus protein 5; MED24; SURF5; surf-5; MGC48682; |
| mRNA Refseq | NM_133640 |
| Protein Refseq | NP_598395 |
| MIM | 185641 |
| UniProt ID | Q15528 |
| Gene ID | 6837 |
| ◆ Recombinant Proteins | ||
| MED22-808H | Recombinant Human MED22 protein, GST-tagged | +Inquiry |
| MED22-3292R | Recombinant Rat MED22 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MED22-1043H | Recombinant Human MED22 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MED22-4473H | Recombinant Human MED22 Protein, GST-tagged | +Inquiry |
| MED22-6215HF | Recombinant Full Length Human MED22 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MED22-4387HCL | Recombinant Human MED22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MED22 Products
Required fields are marked with *
My Review for All MED22 Products
Required fields are marked with *
