Recombinant Human MED27 Protein, GST-tagged

Cat.No. : MED27-1909H
Product Overview : Human CRSP8 full-length ORF ( AAH02878, 1 a.a. - 70 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 5. [provided by RefSeq, Dec 2011]
Molecular Mass : 33.44 kDa
AA Sequence : MRNKETLEGREKAFIAHFQDNLHSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MED27 mediator complex subunit 27 [ Homo sapiens ]
Official Symbol MED27
Synonyms MED27; mediator complex subunit 27; cofactor required for Sp1 transcriptional activation, subunit 8, 34kDa , CRSP8; mediator of RNA polymerase II transcription subunit 27; CRSP34; TRAP37; CRSP complex subunit 8; p37 TRAP/SMCC/PC2 subunit; transcriptional coactivator CRSP34; cofactor required for Sp1 transcriptional activation, subunit 8, 34kDa; CRSP8; CRAP34; FLJ42238; MGC11274;
Gene ID 9442
mRNA Refseq NM_001253881
Protein Refseq NP_001240810
MIM 605044
UniProt ID Q6P2C8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MED27 Products

Required fields are marked with *

My Review for All MED27 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon