Recombinant Human MED31 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MED31-2587H
Product Overview : MED31 MS Standard C13 and N15-labeled recombinant protein (NP_057144) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
Molecular Mass : 15.8 kDa
AA Sequence : MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSGKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MED31 mediator complex subunit 31 [ Homo sapiens (human) ]
Official Symbol MED31
Synonyms MED31; mediator complex subunit 31; mediator of RNA polymerase II transcription, subunit 31 homolog (S. cerevisiae); mediator of RNA polymerase II transcription subunit 31; CGI 125; Soh1; hSOH1; mediator complex subunit SOH1; mediator of RNA polymerase II transcription, subunit 31 homolog; CGI-125; 3110004H13Rik; FLJ27436; FLJ36714;
Gene ID 51003
mRNA Refseq NM_016060
Protein Refseq NP_057144
UniProt ID Q9Y3C7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MED31 Products

Required fields are marked with *

My Review for All MED31 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon