Recombinant Human MED31 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | MED31-2587H |
| Product Overview : | MED31 MS Standard C13 and N15-labeled recombinant protein (NP_057144) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. |
| Molecular Mass : | 15.8 kDa |
| AA Sequence : | MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSGKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | MED31 mediator complex subunit 31 [ Homo sapiens (human) ] |
| Official Symbol | MED31 |
| Synonyms | MED31; mediator complex subunit 31; mediator of RNA polymerase II transcription, subunit 31 homolog (S. cerevisiae); mediator of RNA polymerase II transcription subunit 31; CGI 125; Soh1; hSOH1; mediator complex subunit SOH1; mediator of RNA polymerase II transcription, subunit 31 homolog; CGI-125; 3110004H13Rik; FLJ27436; FLJ36714; |
| Gene ID | 51003 |
| mRNA Refseq | NM_016060 |
| Protein Refseq | NP_057144 |
| UniProt ID | Q9Y3C7 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MED31 Products
Required fields are marked with *
My Review for All MED31 Products
Required fields are marked with *
