Recombinant Human MEF2A protein, GST-tagged
Cat.No. : | MEF2A-5633H |
Product Overview : | Recombinant Human MEF2A protein(126-258 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 126-258 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MRNHKIAPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLAASSTLTDSSMLSPPQTTLHRNVSPGAPQRPPSTGNAGGMLSTTDLTVPNGAGSSPVGNGFVNSRASPNLIGATGANSLGKVMPTKSPPP |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | MEF2A myocyte enhancer factor 2A [ Homo sapiens ] |
Official Symbol | MEF2A |
Synonyms | MEF2A; myocyte enhancer factor 2A; myocyte-specific enhancer factor 2A; serum response factor-like protein 1; MADS box transcription enhancer factor 2, polypeptide A (myocyte enhancer factor 2A); mef2; ADCAD1; RSRFC4; RSRFC9; |
Gene ID | 4205 |
mRNA Refseq | NM_001130926 |
Protein Refseq | NP_001124398 |
◆ Recombinant Proteins | ||
MEF2A-3640R | Recombinant Rat MEF2A Protein | +Inquiry |
MEF2A-9709M | Recombinant Mouse MEF2A Protein | +Inquiry |
MEF2A-5464M | Recombinant Mouse MEF2A Protein, His (Fc)-Avi-tagged | +Inquiry |
MEF2A-2549R | Recombinant Rhesus Macaque MEF2A Protein, His (Fc)-Avi-tagged | +Inquiry |
MEF2A-6257HF | Recombinant Full Length Human MEF2A Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MEF2A-4376HCL | Recombinant Human MEF2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MEF2A Products
Required fields are marked with *
My Review for All MEF2A Products
Required fields are marked with *