Recombinant Human MEF2A protein, GST-tagged

• Cat.No.: MEF2A-5633H
• Product Overview: Recombinant Human MEF2A protein(126-258 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 126-258 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: MRNHKIAPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLAASSTLTDSSMLSPPQTTLHRNVSPGAPQRPPSTGNAGGMLSTTDLTVPNGAGSSPVGNGFVNSRASPNLIGATGANSLGKVMPTKSPPP
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: MEF2A myocyte enhancer factor 2A [ Homo sapiens ]
• Official Symbol: MEF2A
• Synonyms: MEF2A; myocyte enhancer factor 2A; myocyte-specific enhancer factor 2A; serum response factor-like protein 1; MADS box transcription enhancer factor 2, polypeptide A (myocyte enhancer factor 2A); mef2; ADCAD1; RSRFC4; RSRFC9
• Gene ID: 4205
• mRNA Refseq: NM_001130926
• Protein Refseq: NP_001124398