Recombinant Human MEIG1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MEIG1-4909H |
Product Overview : | MEIG1 MS Standard C13 and N15-labeled recombinant protein (NP_001074305) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | MEIG1 (Meiosis/Spermiogenesis Associated 1) is a Protein Coding gene. Diseases associated with MEIG1 include Cardiomyopathy, Familial Hypertrophic, 7. |
Molecular Mass : | 10.6 kDa |
AA Sequence : | MASSDVKPKSVSHAKKWSEEIENLYRFQQAGYRDETEYRQVKQVSMVDRWPETGYVKKLQRRDNTFYYYNKQRECDDKEVHKVKIYAYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MEIG1 meiosis/spermiogenesis associated 1 [ Homo sapiens (human) ] |
Official Symbol | MEIG1 |
Synonyms | MEIG1 meiosis/spermiogenesis associated 1; SPATA39; bA2K17.3; meiosis expressed gene 1 protein homolog; meiosis expressed gene 1 homolog; spermatogenesis associated 39 |
Gene ID | 644890 |
mRNA Refseq | NM_001080836 |
Protein Refseq | NP_001074305 |
MIM | 614174 |
UniProt ID | Q5JSS6 |
◆ Recombinant Proteins | ||
MEIG1-869H | Recombinant Human MEIG1 Protein, MYC/DDK-tagged | +Inquiry |
MEIG1-2152Z | Recombinant Zebrafish MEIG1 | +Inquiry |
MEIG1-1215H | Recombinant Human MEIG1 | +Inquiry |
Meig1-257M | Recombinant Mouse Meig1 Protein, MYC/DDK-tagged | +Inquiry |
MEIG1-5607C | Recombinant Chicken MEIG1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MEIG1 Products
Required fields are marked with *
My Review for All MEIG1 Products
Required fields are marked with *
0
Inquiry Basket