Recombinant Human MEIS2 Protein, GST-tagged
Cat.No. : | MEIS2-4451H |
Product Overview : | Human MEIS2 full-length ORF ( AAH01516, 1 a.a. - 381 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a homeobox protein belonging to the TALE (three amino acid loop extension) family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs. Multiple transcript variants encoding distinct isoforms have been described for this gene. [provided by RefSeq |
Molecular Mass : | 67.65 kDa |
AA Sequence : | MDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MEIS2 Meis homeobox 2 [ Homo sapiens ] |
Official Symbol | MEIS2 |
Synonyms | MEIS2; Meis homeobox 2; Meis (mouse) homolog 2 , Meis1, myeloid ecotropic viral integration site 1 homolog 2 (mouse); homeobox protein Meis2; HsT18361; MRG1; Meis homolog 2; Meis1-related gene 1; meis1-related protein 1; TALE homeobox protein Meis2; Meis1, myeloid ecotropic viral integration site 1 homolog 2; MGC2820; |
Gene ID | 4212 |
mRNA Refseq | NM_001220482 |
Protein Refseq | NP_001207411 |
MIM | 601740 |
UniProt ID | O14770 |
◆ Recombinant Proteins | ||
MEIS2-19HFL | Recombinant Full Length Human MEIS2 Protein transcript variant d, C-Flag-tagged | +Inquiry |
MEIS2-5471M | Recombinant Mouse MEIS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MEIS2-3256H | Recombinant Human MEIS2 Protein(79-270 aa), His-tagged | +Inquiry |
MEIS2-6366C | Recombinant Chicken MEIS2 | +Inquiry |
MEIS2-18HFL | Recombinant Full Length Human MEIS2 Protein transcript variant f, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MEIS2-4371HCL | Recombinant Human MEIS2 293 Cell Lysate | +Inquiry |
MEIS2-4370HCL | Recombinant Human MEIS2 293 Cell Lysate | +Inquiry |
MEIS2-4372HCL | Recombinant Human MEIS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MEIS2 Products
Required fields are marked with *
My Review for All MEIS2 Products
Required fields are marked with *
0
Inquiry Basket