Recombinant Human MEIS2 protein, His-tagged

Cat.No. : MEIS2-3255H
Product Overview : Recombinant Human MEIS2 protein(1 - 381 aa), fused to His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1 - 381 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name MEIS2 Meis homeobox 2 [ Homo sapiens ]
Official Symbol MEIS2
Synonyms MEIS2; Meis homeobox 2; Meis (mouse) homolog 2 , Meis1, myeloid ecotropic viral integration site 1 homolog 2 (mouse); homeobox protein Meis2; HsT18361; MRG1; Meis homolog 2; Meis1-related gene 1; meis1-related protein 1; TALE homeobox protein Meis2; Meis1, myeloid ecotropic viral integration site 1 homolog 2; MGC2820;
Gene ID 4212
mRNA Refseq NM_001220482
Protein Refseq NP_001207411
MIM 601740
UniProt ID O14770

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MEIS2 Products

Required fields are marked with *

My Review for All MEIS2 Products

Required fields are marked with *

0
cart-icon
0
compare icon