Recombinant Human MEIS2 protein, His-tagged
| Cat.No. : | MEIS2-3255H |
| Product Overview : | Recombinant Human MEIS2 protein(1 - 381 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 22, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1 - 381 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | MEIS2 Meis homeobox 2 [ Homo sapiens ] |
| Official Symbol | MEIS2 |
| Synonyms | MEIS2; Meis homeobox 2; Meis (mouse) homolog 2 , Meis1, myeloid ecotropic viral integration site 1 homolog 2 (mouse); homeobox protein Meis2; HsT18361; MRG1; Meis homolog 2; Meis1-related gene 1; meis1-related protein 1; TALE homeobox protein Meis2; Meis1, myeloid ecotropic viral integration site 1 homolog 2; MGC2820; |
| Gene ID | 4212 |
| mRNA Refseq | NM_001220482 |
| Protein Refseq | NP_001207411 |
| MIM | 601740 |
| UniProt ID | O14770 |
| ◆ Recombinant Proteins | ||
| MEIS2-6366C | Recombinant Chicken MEIS2 | +Inquiry |
| MEIS2-3256H | Recombinant Human MEIS2 Protein(79-270 aa), His-tagged | +Inquiry |
| MEIS2-488H | Recombinant Human MEIS2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MEIS2-19HFL | Recombinant Full Length Human MEIS2 Protein transcript variant d, C-Flag-tagged | +Inquiry |
| MEIS2-6151H | Recombinant Human MEIS2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MEIS2-4370HCL | Recombinant Human MEIS2 293 Cell Lysate | +Inquiry |
| MEIS2-4371HCL | Recombinant Human MEIS2 293 Cell Lysate | +Inquiry |
| MEIS2-4372HCL | Recombinant Human MEIS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MEIS2 Products
Required fields are marked with *
My Review for All MEIS2 Products
Required fields are marked with *
