Recombinant Human MEIS3 protein, His&Myc-tagged
Cat.No. : | MEIS3-4387H |
Product Overview : | Recombinant Human MEIS3 protein(Q99687)(1-375aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-375aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 48.6 kDa |
AA Sequence : | MARRYDELPHYPGIVDGPAALASFPETVPAVPGPYGPHRPPQPLPPGLDSDGLKREKDEIYGHPLFPLLALVFEKCELATCSPRDGAGAGLGTPPGGDVCSSDSFNEDIAAFAKQVRSERPLFSSNPELDNLMIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRDGGCREDFEDYPASCPSLPDQNNMWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSGGEDEDLDQERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQPIGGYTETQPHVAVRPPGSVGMSLNLEGEWHYL |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | MEIS3 Meis homeobox 3 [ Homo sapiens ] |
Official Symbol | MEIS3 |
Synonyms | MEIS3; Meis homeobox 3; Meis1, myeloid ecotropic viral integration site 1 homolog 3 (mouse); homeobox protein Meis3; DKFZp547H236; MRG2; meis1-related protein 2; Meis1, myeloid ecotropic viral integration site 1 homolog 3; |
Gene ID | 56917 |
mRNA Refseq | NM_001009813 |
Protein Refseq | NP_001009813 |
UniProt ID | Q99687 |
◆ Recombinant Proteins | ||
MEIS3-1774H | Recombinant Human MEIS3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MEIS3-9724M | Recombinant Mouse MEIS3 Protein | +Inquiry |
MEIS3-4499H | Recombinant Human MEIS3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MEIS3-9292Z | Recombinant Zebrafish MEIS3 | +Inquiry |
MEIS3-5472M | Recombinant Mouse MEIS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MEIS3-4369HCL | Recombinant Human MEIS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MEIS3 Products
Required fields are marked with *
My Review for All MEIS3 Products
Required fields are marked with *