Recombinant Human MEIS3 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | MEIS3-4499H |
| Product Overview : | MEIS3 MS Standard C13 and N15-labeled recombinant protein (NP_001009813) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a homeobox protein and probable transcriptional regulator. The orthologous protein in mouse controls expression of 3-phosphoinositide dependent protein kinase 1, which promotes survival of pancreatic beta-cells. |
| Molecular Mass : | 39.1 kDa |
| AA Sequence : | MARRYDELPHYPGIVDGPAALASFPETVPAVPGPYGPHRPPQPLPPGLDSDGLKREKDEIYGHPLFPLLALVFEKCELATCSPRDGAGAGLGTPPGGDVCSSDSFNEDIAAFAKQVRSERPLFSSNPELDNLMIQAIQVLRFHLLELEKGKMPIDLVIEDRDGGCREDFEDYPASCPSLPDQNNMWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSGGEDEDLDQERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQPIGGYTETQPHVAVRPPGSVGMSLNLEGEWHYLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | MEIS3 Meis homeobox 3 [ Homo sapiens (human) ] |
| Official Symbol | MEIS3 |
| Synonyms | MEIS3; Meis homeobox 3; Meis1, myeloid ecotropic viral integration site 1 homolog 3 (mouse); homeobox protein Meis3; DKFZp547H236; MRG2; meis1-related protein 2; Meis1, myeloid ecotropic viral integration site 1 homolog 3; |
| Gene ID | 56917 |
| mRNA Refseq | NM_001009813 |
| Protein Refseq | NP_001009813 |
| UniProt ID | Q99687 |
| ◆ Recombinant Proteins | ||
| MEIS3-5472M | Recombinant Mouse MEIS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MEIS3-9724M | Recombinant Mouse MEIS3 Protein | +Inquiry |
| MEIS3-1774H | Recombinant Human MEIS3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MEIS3-9292Z | Recombinant Zebrafish MEIS3 | +Inquiry |
| MEIS3-6128HF | Recombinant Full Length Human MEIS3 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MEIS3-4369HCL | Recombinant Human MEIS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MEIS3 Products
Required fields are marked with *
My Review for All MEIS3 Products
Required fields are marked with *
