Recombinant Human MEMO1 protein, GST-tagged
Cat.No. : | MEMO1-301618H |
Product Overview : | Recombinant Human MEMO1 (1-297 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-His297 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MSNRVVCREASHAGSWYTASGPHLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYTAKAMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDESQGEIYRSIEHLDKMGMSIIEQLDPVSFSNYLKKYHNTICGRHPIGVLLNAITELQKNGMNMSFSFLNYAQSSQCRNWQDSSVSYAAGALTVH |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | MEMO1 mediator of cell motility 1 [ Homo sapiens ] |
Official Symbol | MEMO1 |
Synonyms | MEMO; C2orf4; CGI-27; NS5ATP7 |
Gene ID | 51072 |
mRNA Refseq | NM_015955.2 |
Protein Refseq | NP_057039.1 |
MIM | 611786 |
UniProt ID | Q9Y316 |
◆ Recombinant Proteins | ||
MEMO1-3645R | Recombinant Rat MEMO1 Protein | +Inquiry |
MEMO1-3301R | Recombinant Rat MEMO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MEMO1-4134C | Recombinant Chicken MEMO1 | +Inquiry |
MEMO1-432C | Recombinant Cynomolgus Monkey MEMO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MEMO1-301618H | Recombinant Human MEMO1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MEMO1-4367HCL | Recombinant Human MEMO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MEMO1 Products
Required fields are marked with *
My Review for All MEMO1 Products
Required fields are marked with *
0
Inquiry Basket