Recombinant Human MESP1 protein, GST-tagged
| Cat.No. : | MESP1-3222H |
| Product Overview : | Recombinant Human MESP1 protein(1-72 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-72 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MAQPLCPPLSESWMLSAAWGPTRRPPPSDKDCGRSLVSSPDSWGSTPADSPVASPARPGTLRDPRAPSVGRR |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | MESP1 mesoderm posterior 1 homolog (mouse) [ Homo sapiens ] |
| Official Symbol | MESP1 |
| Synonyms | MESP1; mesoderm posterior 1 homolog (mouse); mesoderm posterior protein 1; bHLHc5; MGC10676; class C basic helix-loop-helix protein 5; |
| Gene ID | 55897 |
| mRNA Refseq | NM_018670 |
| Protein Refseq | NP_061140 |
| MIM | 608689 |
| UniProt ID | Q9BRJ9 |
| ◆ Recombinant Proteins | ||
| MESP1-9737M | Recombinant Mouse MESP1 Protein | +Inquiry |
| MESP1-5483M | Recombinant Mouse MESP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Mesp1-4036M | Recombinant Mouse Mesp1 Protein, Myc/DDK-tagged | +Inquiry |
| MESP1-6143HF | Recombinant Full Length Human MESP1 Protein, GST-tagged | +Inquiry |
| MESP1-3223H | Recombinant Human MESP1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MESP1 Products
Required fields are marked with *
My Review for All MESP1 Products
Required fields are marked with *
