Recombinant Human MET Protein, GST-tagged

Cat.No. : MET-4419H
Product Overview : Human MET partial ORF ( NM_000245, 26 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The proto-oncogene MET product is the hepatocyte growth factor receptor and encodes tyrosine-kinase activity. The primary single chain precursor protein is post-translationally cleaved to produce the alpha and beta subunits, which are disulfide linked to form the mature receptor. Various mutations in the MET gene are associated with papillary renal carcinoma. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Molecular Mass : 36.63 kDa
AA Sequence : CKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEHHIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMALVVDTY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MET met proto-oncogene (hepatocyte growth factor receptor) [ Homo sapiens ]
Official Symbol MET
Synonyms MET; met proto-oncogene (hepatocyte growth factor receptor); hepatocyte growth factor receptor; HGFR; RCCP2; SF receptor; HGF receptor; oncogene MET; HGF/SF receptor; proto-oncogene c-Met; scatter factor receptor; tyrosine-protein kinase Met; met proto-oncogene tyrosine kinase; AUTS9; c-Met;
Gene ID 4233
mRNA Refseq NM_000245
Protein Refseq NP_000236
MIM 164860
UniProt ID P08581

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MET Products

Required fields are marked with *

My Review for All MET Products

Required fields are marked with *

0
cart-icon
0
compare icon