Recombinant Human MET protein, GST-tagged
Cat.No. : | MET-301166H |
Product Overview : | Recombinant Human MET (965-1085 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Gly965-Gly1085 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | GSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIG |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | MET met proto-oncogene (hepatocyte growth factor receptor) [ Homo sapiens ] |
Official Symbol | MET |
Synonyms | MET; met proto-oncogene (hepatocyte growth factor receptor); hepatocyte growth factor receptor; HGFR; RCCP2; SF receptor; HGF receptor; oncogene MET; HGF/SF receptor; proto-oncogene c-Met; scatter factor receptor; tyrosine-protein kinase Met; met proto-oncogene tyrosine kinase; AUTS9; c-Met; |
Gene ID | 4233 |
mRNA Refseq | NM_000245 |
Protein Refseq | NP_000236 |
MIM | 164860 |
UniProt ID | P08581 |
◆ Recombinant Proteins | ||
Met-1060R | Recombinant Rat Met Proto-Oncogene, GST-tagged | +Inquiry |
MET-36H | Recombinant Human MET Protein, GST-tagged | +Inquiry |
Met-194HAF488 | Recombinant Human Met Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
Met-31HF | Recombinant Human Met Protein, Fc/His-tagged, FITC conjugated | +Inquiry |
MET-3653R | Recombinant Rat MET Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MET-2529HCL | Recombinant Human MET cell lysate | +Inquiry |
MET-1054RCL | Recombinant Rat MET cell lysate | +Inquiry |
MET-2047MCL | Recombinant Mouse MET cell lysate | +Inquiry |
MET-001HCL | Recombinant Human MET cell lysate | +Inquiry |
MET-1931CCL | Recombinant Canine MET cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MET Products
Required fields are marked with *
My Review for All MET Products
Required fields are marked with *
0
Inquiry Basket