Recombinant Human MET protein, His-tagged
Cat.No. : | MET-2582H |
Product Overview : | Recombinant Human MET protein(965-1085 aa), fused to His tag, was expressed in E. coli. |
Availability | October 04, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 965-1085 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | GSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIG |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MET met proto-oncogene (hepatocyte growth factor receptor) [ Homo sapiens ] |
Official Symbol | MET |
Synonyms | MET; met proto-oncogene (hepatocyte growth factor receptor); hepatocyte growth factor receptor; HGFR; RCCP2; SF receptor; HGF receptor; oncogene MET; HGF/SF receptor; proto-oncogene c-Met; scatter factor receptor; tyrosine-protein kinase Met; met proto-oncogene tyrosine kinase; AUTS9; c-Met; |
Gene ID | 4233 |
mRNA Refseq | NM_000245 |
Protein Refseq | NP_000236 |
MIM | 164860 |
UniProt ID | P08581 |
◆ Recombinant Proteins | ||
MET-218H | Recombinant Human MET protein, DDK/His-tagged | +Inquiry |
MET-7295HF | Recombinant Human MET Protein, His/GST-tagged, FITC conjugated | +Inquiry |
Met-194HAF488 | Recombinant Human Met Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
Met-730MA | Recombinant Mouse Met protein, Fc-tagged, APC labeled | +Inquiry |
MET-1624HAF555 | Active Recombinant Human MET Protein, Fc/His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
MET-2047MCL | Recombinant Mouse MET cell lysate | +Inquiry |
MET-001HCL | Recombinant Human MET cell lysate | +Inquiry |
MET-001CCL | Recombinant Cynomolgus MET cell lysate | +Inquiry |
MET-1054RCL | Recombinant Rat MET cell lysate | +Inquiry |
MET-2529HCL | Recombinant Human MET cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MET Products
Required fields are marked with *
My Review for All MET Products
Required fields are marked with *