Recombinant Human MET protein, His-tagged

Cat.No. : MET-2582H
Product Overview : Recombinant Human MET protein(965-1085 aa), fused to His tag, was expressed in E. coli.
Availability July 31, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 965-1085 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : GSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIG
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name MET met proto-oncogene (hepatocyte growth factor receptor) [ Homo sapiens ]
Official Symbol MET
Synonyms MET; met proto-oncogene (hepatocyte growth factor receptor); hepatocyte growth factor receptor; HGFR; RCCP2; SF receptor; HGF receptor; oncogene MET; HGF/SF receptor; proto-oncogene c-Met; scatter factor receptor; tyrosine-protein kinase Met; met proto-oncogene tyrosine kinase; AUTS9; c-Met;
Gene ID 4233
mRNA Refseq NM_000245
Protein Refseq NP_000236
MIM 164860
UniProt ID P08581

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MET Products

Required fields are marked with *

My Review for All MET Products

Required fields are marked with *

0
cart-icon