Recombinant Human METAP2 protein(51-190 aa), C-His-tagged
Cat.No. : | METAP2-2780H |
Product Overview : | Recombinant Human METAP2 protein(P50579)(51-190 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 51-190 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | AGEQEPDKESGASVDEVARQLERSALEDKERDEDDEDGDGDGDGATGKKKKKKKKKRGPKVQTDPPSVPICDLYPNGVFPKGQECEYPPTQDGRTAAWRTTSEEKKALDQASEEIWNDFREAAEAHRQVRKYVMSWIKPG |
Gene Name | METAP2 methionyl aminopeptidase 2 [ Homo sapiens ] |
Official Symbol | METAP2 |
Synonyms | METAP2; methionyl aminopeptidase 2; methionine aminopeptidase 2; MAP2; MNPEP; p67; Peptidase M; MAP 2; metAP 2; peptidase M 2; eIF-2-associated p67 homolog; initiation factor 2-associated 67 kDa glycoprotein; p67eIF2; |
Gene ID | 10988 |
mRNA Refseq | NM_006838 |
Protein Refseq | NP_006829 |
MIM | 601870 |
UniProt ID | P50579 |
◆ Recombinant Proteins | ||
METAP2-203H | Active Recombinant Human METAP2 protein, His-tagged | +Inquiry |
METAP2-6152HF | Recombinant Full Length Human METAP2 Protein, GST-tagged | +Inquiry |
METAP2-2780H | Recombinant Human METAP2 protein(51-190 aa), C-His-tagged | +Inquiry |
METAP2-3948H | Recombinant Human METAP2 Protein (Ala2-Tyr478), N-His tagged | +Inquiry |
METAP2-2736R | Recombinant Rhesus monkey METAP2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
METAP2-457MCL | Recombinant Mouse METAP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All METAP2 Products
Required fields are marked with *
My Review for All METAP2 Products
Required fields are marked with *