Recombinant Human METAP2 protein(51-190 aa), C-His-tagged

Cat.No. : METAP2-2780H
Product Overview : Recombinant Human METAP2 protein(P50579)(51-190 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 51-190 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : AGEQEPDKESGASVDEVARQLERSALEDKERDEDDEDGDGDGDGATGKKKKKKKKKRGPKVQTDPPSVPICDLYPNGVFPKGQECEYPPTQDGRTAAWRTTSEEKKALDQASEEIWNDFREAAEAHRQVRKYVMSWIKPG
Gene Name METAP2 methionyl aminopeptidase 2 [ Homo sapiens ]
Official Symbol METAP2
Synonyms METAP2; methionyl aminopeptidase 2; methionine aminopeptidase 2; MAP2; MNPEP; p67; Peptidase M; MAP 2; metAP 2; peptidase M 2; eIF-2-associated p67 homolog; initiation factor 2-associated 67 kDa glycoprotein; p67eIF2;
Gene ID 10988
mRNA Refseq NM_006838
Protein Refseq NP_006829
MIM 601870
UniProt ID P50579

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All METAP2 Products

Required fields are marked with *

My Review for All METAP2 Products

Required fields are marked with *

0
cart-icon