Recombinant Human methionyl aminopeptidase type 1D, mitochondrial protein, His tagged
Cat.No. : | METAP1D-2468H |
Product Overview : | Recombinant Human METAP1D protein (44-335aa) with His tag was expressed in Baculovirus-Insect Cells. |
Availability | October 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 44-335aa |
Description : | The N-terminal methionine excision pathway is an essential process in which the N-terminal methionine is removed from many proteins, thus facilitating subsequent protein modification. In mitochondria, enzymes that catalyze this reaction are celled methionine aminopeptidases (MetAps, or MAPs; EC 3.4.11.18) (Serero et al., 2003 [PubMed 14532271]). |
Tag : | C-His |
Molecular Mass : | 33 kDa |
AA Sequence : | MRQRDISHSIVLPAAVSSAHPVPKHIKKPDYVTTGIVPDWGDSIEVKNEDQIQGLHQACQLARHVLLLAGKSLKVDMTTEEIDALVHREIISHNAYPSPLGYGGFPKSVCTSVNNVLCHGIPDSRPLQDGDIINIDVTVYYNGYHGDTSETFLVGNVDECGKKLVEVARRCRDEAIAACRAGAPFSVIGNTISHITHQNGFQVCPHFVGHGIGSYFHGHPEIWHHANDSDLPMEEGMAFTIEPIITEGSPEFKVLEDAWTVVSLDNQRSAQFEHTVLITSRGAQILTKLPHEAHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4 |
Concentration : | 1 mg/mL by BCA |
Gene Name | METAP1D methionyl aminopeptidase type 1D, mitochondrial [ Homo sapiens (human) ] |
Official Symbol | METAP1D |
Synonyms | METAP1D; methionyl aminopeptidase type 1D (mitochondrial); methionine aminopeptidase 1D, mitochondrial; MAP1D; Metap1l; methionine aminopeptidase 1D; CDS of metAP-3 within PCR fragment; methionyl aminopeptidase type 1D, mitochondrial |
Gene ID | 254042 |
mRNA Refseq | NM_199227 |
Protein Refseq | NP_954697 |
MIM | 610267 |
UniProt ID | Q6UB28 |
◆ Recombinant Proteins | ||
MAP1D-2201H | Active Recombinant Human MAP1D protein, His-tagged | +Inquiry |
METAP1D-4167H | Recombinant Human METAP1D Protein (Arg44-Ala335), N/C-His tagged | +Inquiry |
METAP1D-2999Z | Recombinant Zebrafish METAP1D | +Inquiry |
METAP1D-2467H | Recombinant human METAP1D, His-tagged | +Inquiry |
METAP1D-9741M | Recombinant Mouse METAP1D Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
METAP1D-689HCL | Recombinant Human METAP1D cell lysate | +Inquiry |
METAP1D-4515HCL | Recombinant Human MAP1D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All METAP1D Products
Required fields are marked with *
My Review for All METAP1D Products
Required fields are marked with *