Recombinant Human methionyl aminopeptidase type 1D, mitochondrial protein, His tagged
| Cat.No. : | METAP1D-2468H |
| Product Overview : | Recombinant Human METAP1D protein (44-335aa) with His tag was expressed in Baculovirus-Insect Cells. |
| Availability | January 08, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | His |
| Protein Length : | 44-335aa |
| Description : | The N-terminal methionine excision pathway is an essential process in which the N-terminal methionine is removed from many proteins, thus facilitating subsequent protein modification. In mitochondria, enzymes that catalyze this reaction are celled methionine aminopeptidases (MetAps, or MAPs; EC 3.4.11.18) (Serero et al., 2003 [PubMed 14532271]). |
| Tag : | C-His |
| Molecular Mass : | 33 kDa |
| AA Sequence : | MRQRDISHSIVLPAAVSSAHPVPKHIKKPDYVTTGIVPDWGDSIEVKNEDQIQGLHQACQLARHVLLLAGKSLKVDMTTEEIDALVHREIISHNAYPSPLGYGGFPKSVCTSVNNVLCHGIPDSRPLQDGDIINIDVTVYYNGYHGDTSETFLVGNVDECGKKLVEVARRCRDEAIAACRAGAPFSVIGNTISHITHQNGFQVCPHFVGHGIGSYFHGHPEIWHHANDSDLPMEEGMAFTIEPIITEGSPEFKVLEDAWTVVSLDNQRSAQFEHTVLITSRGAQILTKLPHEAHHHHHHHH |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4 |
| Concentration : | 1 mg/mL by BCA |
| Gene Name | METAP1D methionyl aminopeptidase type 1D, mitochondrial [ Homo sapiens (human) ] |
| Official Symbol | METAP1D |
| Synonyms | METAP1D; methionyl aminopeptidase type 1D (mitochondrial); methionine aminopeptidase 1D, mitochondrial; MAP1D; Metap1l; methionine aminopeptidase 1D; CDS of metAP-3 within PCR fragment; methionyl aminopeptidase type 1D, mitochondrial |
| Gene ID | 254042 |
| mRNA Refseq | NM_199227 |
| Protein Refseq | NP_954697 |
| MIM | 610267 |
| UniProt ID | Q6UB28 |
| ◆ Recombinant Proteins | ||
| METAP1D-5485M | Recombinant Mouse METAP1D Protein, His (Fc)-Avi-tagged | +Inquiry |
| MAP1D-2201H | Active Recombinant Human MAP1D protein, His-tagged | +Inquiry |
| METAP1D-2999Z | Recombinant Zebrafish METAP1D | +Inquiry |
| METAP1D-14H | Recombinant Human METAP1D Protein, N-Met,C-His-tagged | +Inquiry |
| METAP1D-4167H | Recombinant Human METAP1D Protein (Arg44-Ala335), N/C-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| METAP1D-689HCL | Recombinant Human METAP1D cell lysate | +Inquiry |
| METAP1D-4515HCL | Recombinant Human MAP1D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All METAP1D Products
Required fields are marked with *
My Review for All METAP1D Products
Required fields are marked with *
