Recombinant Human METTL21C Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | METTL21C-3648H |
Product Overview : | C13orf39 MS Standard C13 and N15-labeled recombinant protein (NP_001010977) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | METTL21C (Methyltransferase Like 21C) is a Protein Coding gene. Diseases associated with METTL21C include Chromosome 4Q21 Deletion Syndrome and Waardenburg Syndrome, Type 3. Gene Ontology (GO) annotations related to this gene include protein-lysine N-methyltransferase activity. An important paralog of this gene is EEF1AKMT3. |
Molecular Mass : | 29.6 kDa |
AA Sequence : | MDVCLSSAQQPGRRGEGLSSPGGWLEAEKKGAPQKDSTGGVLEESNKIEPSLHSLQKFVPTDYASYTQEHYRFAGKEIVIQESIESYGAVVWPGAMALCQYLEEHAEELNFQDAKILEIGAGPGLVSIVASILGAQVTATDLPDVLGNLQYNLLKNTLQCTAHLPEVKELVWGEDLDKNFPKSAFYYDYVLASDVVYHHYFLDKLLTTMVYLSQPGTVLLWANKFRFSTDYEFLDKFKQVFDTTLLAEYPESSVKLFKGILKWDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | METTL21C methyltransferase like 21C [ Homo sapiens (human) ] |
Official Symbol | METTL21C |
Synonyms | METTL21C; methyltransferase like 21C; C13orf39, chromosome 13 open reading frame 39; methyltransferase-like protein 21C; LOC196541; C13orf39; |
Gene ID | 196541 |
mRNA Refseq | NM_001010977 |
Protein Refseq | NP_001010977 |
MIM | 615259 |
UniProt ID | Q5VZV1 |
◆ Recombinant Proteins | ||
Mettl21c-1774M | Recombinant Mouse Mettl21c Protein, His-tagged | +Inquiry |
METTL21C-3648H | Recombinant Human METTL21C Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
METTL21C-531H | Recombinant Human METTL21C Protein, GST-tagged | +Inquiry |
METTL21C-1782HF | Recombinant Full Length Human METTL21C Protein, GST-tagged | +Inquiry |
Mettl21c-1638R | Recombinant Rat Mettl21c protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
METTL21C-8295HCL | Recombinant Human C13orf39 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All METTL21C Products
Required fields are marked with *
My Review for All METTL21C Products
Required fields are marked with *