Recombinant Human METTL21C Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | METTL21C-3648H |
| Product Overview : | C13orf39 MS Standard C13 and N15-labeled recombinant protein (NP_001010977) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | METTL21C (Methyltransferase Like 21C) is a Protein Coding gene. Diseases associated with METTL21C include Chromosome 4Q21 Deletion Syndrome and Waardenburg Syndrome, Type 3. Gene Ontology (GO) annotations related to this gene include protein-lysine N-methyltransferase activity. An important paralog of this gene is EEF1AKMT3. |
| Molecular Mass : | 29.6 kDa |
| AA Sequence : | MDVCLSSAQQPGRRGEGLSSPGGWLEAEKKGAPQKDSTGGVLEESNKIEPSLHSLQKFVPTDYASYTQEHYRFAGKEIVIQESIESYGAVVWPGAMALCQYLEEHAEELNFQDAKILEIGAGPGLVSIVASILGAQVTATDLPDVLGNLQYNLLKNTLQCTAHLPEVKELVWGEDLDKNFPKSAFYYDYVLASDVVYHHYFLDKLLTTMVYLSQPGTVLLWANKFRFSTDYEFLDKFKQVFDTTLLAEYPESSVKLFKGILKWDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | METTL21C methyltransferase like 21C [ Homo sapiens (human) ] |
| Official Symbol | METTL21C |
| Synonyms | METTL21C; methyltransferase like 21C; C13orf39, chromosome 13 open reading frame 39; methyltransferase-like protein 21C; LOC196541; C13orf39; |
| Gene ID | 196541 |
| mRNA Refseq | NM_001010977 |
| Protein Refseq | NP_001010977 |
| MIM | 615259 |
| UniProt ID | Q5VZV1 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All METTL21C Products
Required fields are marked with *
My Review for All METTL21C Products
Required fields are marked with *


