Recombinant Human METTL6 protein, His-tagged
| Cat.No. : | METTL6-3981H |
| Product Overview : | Recombinant Human METTL6 protein(1-250 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | February 04, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-250 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AASequence : | MASLQRKGLQARILTSEEEEKLKRDQTLVSDFKQQKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQKLTMLEAGCGVGNCLFPLLEEDPNIFAYACDFSPRAIEYVKQNPLYDTERCKVFQCDLTKDDLLDHVPPESVDVVMLIFVLSAVHPDKMHLVLQNIYKVLKPGKSVLFRDYGLYDHAMLRFKASSKLGENFYVRQDGTRSYFFTDDFLAQLFMDTGYEEVVNEYVFRETVN |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | METTL6 methyltransferase like 6 [ Homo sapiens ] |
| Official Symbol | METTL6 |
| Synonyms | METTL6; methyltransferase like 6; methyltransferase-like protein 6; MGC24132; |
| Gene ID | 131965 |
| mRNA Refseq | NM_152396 |
| Protein Refseq | NP_689609 |
| UniProt ID | Q8TCB7 |
| ◆ Recombinant Proteins | ||
| METTL6-839H | Recombinant Human METTL6, GST-tagged | +Inquiry |
| METTL6-2569R | Recombinant Rhesus Macaque METTL6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| METTL6-3661R | Recombinant Rat METTL6 Protein | +Inquiry |
| METTL6-6175HF | Recombinant Full Length Human METTL6 Protein, GST-tagged | +Inquiry |
| Mettl6-4050M | Recombinant Mouse Mettl6 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| METTL6-1084HCL | Recombinant Human METTL6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All METTL6 Products
Required fields are marked with *
My Review for All METTL6 Products
Required fields are marked with *
