Recombinant Human METTL6 protein, His-tagged
Cat.No. : | METTL6-3981H |
Product Overview : | Recombinant Human METTL6 protein(1-250 aa), fused to His tag, was expressed in E. coli. |
Availability | July 04, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-250 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MASLQRKGLQARILTSEEEEKLKRDQTLVSDFKQQKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQKLTMLEAGCGVGNCLFPLLEEDPNIFAYACDFSPRAIEYVKQNPLYDTERCKVFQCDLTKDDLLDHVPPESVDVVMLIFVLSAVHPDKMHLVLQNIYKVLKPGKSVLFRDYGLYDHAMLRFKASSKLGENFYVRQDGTRSYFFTDDFLAQLFMDTGYEEVVNEYVFRETVN |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | METTL6 methyltransferase like 6 [ Homo sapiens ] |
Official Symbol | METTL6 |
Synonyms | METTL6; methyltransferase like 6; methyltransferase-like protein 6; MGC24132; |
Gene ID | 131965 |
mRNA Refseq | NM_152396 |
Protein Refseq | NP_689609 |
UniProt ID | Q8TCB7 |
◆ Recombinant Proteins | ||
METTL6-4400H | Recombinant Human METTL6 Protein, GST-tagged | +Inquiry |
Mettl6-4050M | Recombinant Mouse Mettl6 Protein, Myc/DDK-tagged | +Inquiry |
METTL6-2554H | Recombinant Human METTL6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
METTL6-10547Z | Recombinant Zebrafish METTL6 | +Inquiry |
METTL6-2569R | Recombinant Rhesus Macaque METTL6 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
METTL6-1084HCL | Recombinant Human METTL6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All METTL6 Products
Required fields are marked with *
My Review for All METTL6 Products
Required fields are marked with *