Recombinant Human MFAP2 Protein, GST-tagged

Cat.No. : MFAP2-4392H
Product Overview : Human MFAP2 partial ORF ( NP_002394, 76 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq
Molecular Mass : 34.87 kDa
AA Sequence : PAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRTVCAHEELLRADLCRDKFS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MFAP2 microfibrillar-associated protein 2 [ Homo sapiens ]
Official Symbol MFAP2
Synonyms MFAP2; microfibrillar-associated protein 2; MAGP; MAGP 1; microfibril-associated glycoprotein 1; MAGP1; MAGP-1; FLJ50901;
Gene ID 4237
mRNA Refseq NM_001135247
Protein Refseq NP_001128719
MIM 156790
UniProt ID P55001

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MFAP2 Products

Required fields are marked with *

My Review for All MFAP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon