Recombinant Human MFAP2 Protein, GST-tagged

• Cat.No.: MFAP2-4392H
• Product Overview: Human MFAP2 partial ORF ( NP_002394, 76 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 76-158 aa
• Description: Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq
• Molecular Mass: 34.87 kDa
• AA Sequence: PAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRTVCAHEELLRADLCRDKFS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MFAP2 microfibrillar-associated protein 2 [ Homo sapiens ]
• Official Symbol: MFAP2
• Synonyms: MFAP2; microfibrillar-associated protein 2; MAGP; MAGP 1; microfibril-associated glycoprotein 1; MAGP1; MAGP-1; FLJ50901
• Gene ID: 4237
• mRNA Refseq: NM_001135247
• Protein Refseq: NP_001128719
• MIM: 156790
• UniProt ID: P55001