Recombinant Human MFAP2 Protein, GST-tagged
| Cat.No. : | MFAP2-4392H |
| Product Overview : | Human MFAP2 partial ORF ( NP_002394, 76 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 76-158 aa |
| Description : | Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq |
| Molecular Mass : | 34.87 kDa |
| AA Sequence : | PAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRTVCAHEELLRADLCRDKFS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MFAP2 microfibrillar-associated protein 2 [ Homo sapiens ] |
| Official Symbol | MFAP2 |
| Synonyms | MFAP2; microfibrillar-associated protein 2; MAGP; MAGP 1; microfibril-associated glycoprotein 1; MAGP1; MAGP-1; FLJ50901; |
| Gene ID | 4237 |
| mRNA Refseq | NM_001135247 |
| Protein Refseq | NP_001128719 |
| MIM | 156790 |
| UniProt ID | P55001 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MFAP2 Products
Required fields are marked with *
My Review for All MFAP2 Products
Required fields are marked with *
