Recombinant Human MFAP2 Protein, GST-tagged
Cat.No. : | MFAP2-4392H |
Product Overview : | Human MFAP2 partial ORF ( NP_002394, 76 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq |
Molecular Mass : | 34.87 kDa |
AA Sequence : | PAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRTVCAHEELLRADLCRDKFS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MFAP2 microfibrillar-associated protein 2 [ Homo sapiens ] |
Official Symbol | MFAP2 |
Synonyms | MFAP2; microfibrillar-associated protein 2; MAGP; MAGP 1; microfibril-associated glycoprotein 1; MAGP1; MAGP-1; FLJ50901; |
Gene ID | 4237 |
mRNA Refseq | NM_001135247 |
Protein Refseq | NP_001128719 |
MIM | 156790 |
UniProt ID | P55001 |
◆ Recombinant Proteins | ||
MFAP2-1715H | Recombinant Human MFAP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MFAP2-4539H | Recombinant Human MFAP2 Protein (Leu6-Val162), His tagged | +Inquiry |
MFAP2-918H | Recombinant Human MFAP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MFAP2-3615Z | Recombinant Zebrafish MFAP2 | +Inquiry |
MFAP2-4392H | Recombinant Human MFAP2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MFAP2-4351HCL | Recombinant Human MFAP2 293 Cell Lysate | +Inquiry |
MFAP2-4352HCL | Recombinant Human MFAP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MFAP2 Products
Required fields are marked with *
My Review for All MFAP2 Products
Required fields are marked with *
0
Inquiry Basket