Recombinant Human MFAP4 Protein, GST-tagged
| Cat.No. : | MFAP4-4389H |
| Product Overview : | Human MFAP4 full-length ORF ( NP_002395.1, 1 a.a. - 255 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a protein with similarity to a bovine microfibril-associated protein. The protein has binding specificities for both collagen and carbohydrate. It is thought to be an extracellular matrix protein which is involved in cell adhesion or intercellular interactions. The gene is located within the Smith-Magenis syndrome region. [provided by RefSeq |
| Molecular Mass : | 55 kDa |
| AA Sequence : | MKALLALPLLLLLSTPPCAPQVSGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLKQKYELRVDLEDFENNTAYAKYADFSISPNAVSAEEDGYTLFVAGFEDGGAGDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MFAP4 microfibrillar-associated protein 4 [ Homo sapiens ] |
| Official Symbol | MFAP4 |
| Synonyms | MFAP4; microfibrillar-associated protein 4; microfibril-associated glycoprotein 4; microfibril associated glycoprotein 4; |
| Gene ID | 4239 |
| mRNA Refseq | NM_001198695 |
| Protein Refseq | NP_001185624 |
| MIM | 600596 |
| UniProt ID | P55083 |
| ◆ Recombinant Proteins | ||
| MFAP4-5511M | Recombinant Mouse MFAP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MFAP4-1509C | Recombinant Cynomolgus MFAP4 protein, His-tagged | +Inquiry |
| MFAP4-3698H | Recombinant Human MFAP4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MFAP4-4540H | Recombinant Human MFAP4 Protein (Val22-Ala255), C-His tagged | +Inquiry |
| Mfap4-3533M | Recombinant Mouse Mfap4 protein, His-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MFAP4-4349HCL | Recombinant Human MFAP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MFAP4 Products
Required fields are marked with *
My Review for All MFAP4 Products
Required fields are marked with *
