Recombinant Human MGAT2, His-tagged
Cat.No. : | MGAT2-92H |
Product Overview : | Recombinant Human Mannoside Acetylglucosaminyltransferase 2/MGAT2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Arg30-Gln447) of Human MGAT2 fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 30-447 a.a. |
Description : | Mannoside Acetylglucosaminyltransferase 2 (MGAT2) is a single-pass type II membrane protein that contains the typical glycosyltransferase domains: a short N-terminal cytoplasmic domain, a hydrophobic non-cleavable signal-anchor domain and a C-terminal catalytic domain. MGAT2 catalyzes an essential step in the conversion of oligo-mannose to complex N-glycans. Defects in MGAT2 are the cause of congenital disorder of glycosylation type 2A. |
AA Sequence : | RQRKNEALAPPLLDAEPARGAGGRGGDHPSVAVGIRRVSNVSAASLVPAVPQPEADNLTLRYRSL VYQLNFDQTLRNVDKAGTWAPRELVLVVQVHNRPEYLRLLLDSLRKAQGIDNVLVIFSHDFWSTE INQLIAGVNFCPVLQVFFPFSIQLYPNEFPGSDPRDCPRDLPKNAALKLGCINAEYPDSFGHYRE AKFSQTKHHWWWKLHFVWERVKILRDYAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVL SLGTYSASRSFYGMADKVDVKTWKSTEHNMGLALTRNAYQKLIECTDTFCTYDDYNWDWTLQYLT VSCLPKFWKVLVPQIPRIFHAGDCGMHHKKTCRPSTQSAQIESLLNNNKQYMFPETLTISEKFTV VAISPPRKNGGWGDIRDHELCKSYRRLQLDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
◆ Recombinant Proteins | ||
MGAT2-001H | Recombinant Human MGAT2 Protein, His-tagged | +Inquiry |
MGAT2-4369H | Recombinant Human MGAT2 Protein, GST-tagged | +Inquiry |
RFL4819SF | Recombinant Full Length Pig Alpha-1,6-Mannosyl-Glycoprotein 2-Beta-N-Acetylglucosaminyltransferase(Mgat2) Protein, His-Tagged | +Inquiry |
MGAT2-6206HF | Recombinant Full Length Human MGAT2 Protein, GST-tagged | +Inquiry |
MGAT2-3325R | Recombinant Rat MGAT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MGAT2-407HCL | Recombinant Human MGAT2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MGAT2 Products
Required fields are marked with *
My Review for All MGAT2 Products
Required fields are marked with *