Recombinant Human MGAT2, His-tagged
| Cat.No. : | MGAT2-92H |
| Product Overview : | Recombinant Human Mannoside Acetylglucosaminyltransferase 2/MGAT2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Arg30-Gln447) of Human MGAT2 fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 30-447 a.a. |
| Description : | Mannoside Acetylglucosaminyltransferase 2 (MGAT2) is a single-pass type II membrane protein that contains the typical glycosyltransferase domains: a short N-terminal cytoplasmic domain, a hydrophobic non-cleavable signal-anchor domain and a C-terminal catalytic domain. MGAT2 catalyzes an essential step in the conversion of oligo-mannose to complex N-glycans. Defects in MGAT2 are the cause of congenital disorder of glycosylation type 2A. |
| AA Sequence : | RQRKNEALAPPLLDAEPARGAGGRGGDHPSVAVGIRRVSNVSAASLVPAVPQPEADNLTLRYRSL VYQLNFDQTLRNVDKAGTWAPRELVLVVQVHNRPEYLRLLLDSLRKAQGIDNVLVIFSHDFWSTE INQLIAGVNFCPVLQVFFPFSIQLYPNEFPGSDPRDCPRDLPKNAALKLGCINAEYPDSFGHYRE AKFSQTKHHWWWKLHFVWERVKILRDYAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVL SLGTYSASRSFYGMADKVDVKTWKSTEHNMGLALTRNAYQKLIECTDTFCTYDDYNWDWTLQYLT VSCLPKFWKVLVPQIPRIFHAGDCGMHHKKTCRPSTQSAQIESLLNNNKQYMFPETLTISEKFTV VAISPPRKNGGWGDIRDHELCKSYRRLQLDHHHHHH |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
| ◆ Recombinant Proteins | ||
| MGAT2-9808M | Recombinant Mouse MGAT2 Protein | +Inquiry |
| MGAT2-5118H | Recombinant Human MGAT2, His-tagged | +Inquiry |
| MGAT2-08H | Active Recombinant Human MGAT2 Protein (AA 30-447), N-6×His/GFP tagged | +Inquiry |
| MGAT2-5533M | Recombinant Mouse MGAT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MGAT2-517H | Recombinant Human mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MGAT2-407HCL | Recombinant Human MGAT2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MGAT2 Products
Required fields are marked with *
My Review for All MGAT2 Products
Required fields are marked with *
