Recombinant Human MGAT5B Protein, GST-tagged
Cat.No. : | MGAT5B-4362H |
Product Overview : | Human MGAT5B full-length ORF ( AAH62354.1, 1 a.a. - 394 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The MGAT5B gene encodes a beta-1,6-N-acetylglucosaminyltransferase (EC 2.4.1.155) that functions in the synthesis of complex cell surface N-glycans (Kaneko et al., 2003 [PubMed 14623122]).[supplied by OMIM, Nov 2008] |
Molecular Mass : | 70.5 kDa |
AA Sequence : | MITVNPDGKIMVRRCLVTLRPFRLFVLGIGFFTLCFLMTSLGGQFSARRLGDSPFTIRTEVMGGPESRGVLRKMSDLLELMVKRMDALARLENSSELHRAGGDLHFPADRMPPGAGLMERIQAIAQNVSDIAVKVDQILRHSLLLHSKVSEGRRDQCEAPSDPKFPDCSGKVEWMRARWTSDPCYAFFGVDGTECSFLIYLSEVEWFCPPLPWRNQTAAQRAPKPLPKVQAVFRSNLSHLLDLMGSGKESLIFMKKRTKRLTAQWALAAQRLAQKLGATQRDQKQILVHIGFLTEESGDVFSPRVLKGGPLGEMVQWADILTALYVLGHGLRVTVSLKELQRQRRLRSSQEQARCGVMGACEKMLLEGDVASNTLLIEKPSKKETEKCPKNLVT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MGAT5B mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase, isozyme B [ Homo sapiens (human) ] |
Official Symbol | MGAT5B |
Synonyms | MGAT5B; mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase, isozyme B; GnT-IX; GnT-VB; alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B; N-acetylglucosaminyl-transferase Vb; N-acetylglucosaminyltransferase IX; alpha-mannoside beta-1,6-N-acetylglucosaminyltransferase B; beta(1,6)-N-acetylglucosaminyltransferase V; glcNAc-T Vb; hGnTVb; mannoside acetylglucosaminyltransferase 5B; mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase, isoenzyme B; EC 2.4.1.155 |
Gene ID | 146664 |
mRNA Refseq | NM_001199172 |
Protein Refseq | NP_001186101 |
MIM | 612441 |
UniProt ID | Q3V5L5 |
◆ Recombinant Proteins | ||
MGAT5B-6254HF | Recombinant Full Length Human MGAT5B Protein, GST-tagged | +Inquiry |
MGAT5B-9813M | Recombinant Mouse MGAT5B Protein | +Inquiry |
MGAT5B-2583R | Recombinant Rhesus Macaque MGAT5B Protein, His (Fc)-Avi-tagged | +Inquiry |
MGAT5B-5537M | Recombinant Mouse MGAT5B Protein, His (Fc)-Avi-tagged | +Inquiry |
MGAT5B-4362H | Recombinant Human MGAT5B Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MGAT5B Products
Required fields are marked with *
My Review for All MGAT5B Products
Required fields are marked with *
0
Inquiry Basket