Recombinant Human MGAT5B Protein, GST-tagged

• Cat.No.: MGAT5B-4362H
• Product Overview: Human MGAT5B full-length ORF ( AAH62354.1, 1 a.a. - 394 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The MGAT5B gene encodes a beta-1,6-N-acetylglucosaminyltransferase (EC 2.4.1.155) that functions in the synthesis of complex cell surface N-glycans (Kaneko et al., 2003 [PubMed 14623122]).[supplied by OMIM, Nov 2008]
• Molecular Mass: 70.5 kDa
• AA Sequence: MITVNPDGKIMVRRCLVTLRPFRLFVLGIGFFTLCFLMTSLGGQFSARRLGDSPFTIRTEVMGGPESRGVLRKMSDLLELMVKRMDALARLENSSELHRAGGDLHFPADRMPPGAGLMERIQAIAQNVSDIAVKVDQILRHSLLLHSKVSEGRRDQCEAPSDPKFPDCSGKVEWMRARWTSDPCYAFFGVDGTECSFLIYLSEVEWFCPPLPWRNQTAAQRAPKPLPKVQAVFRSNLSHLLDLMGSGKESLIFMKKRTKRLTAQWALAAQRLAQKLGATQRDQKQILVHIGFLTEESGDVFSPRVLKGGPLGEMVQWADILTALYVLGHGLRVTVSLKELQRQRRLRSSQEQARCGVMGACEKMLLEGDVASNTLLIEKPSKKETEKCPKNLVT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MGAT5B mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase, isozyme B [ Homo sapiens (human) ]
• Official Symbol: MGAT5B
• Synonyms: MGAT5B; mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase, isozyme B; GnT-IX; GnT-VB; alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B; N-acetylglucosaminyl-transferase Vb; N-acetylglucosaminyltransferase IX; alpha-mannoside beta-1,6-N-acetylglucosaminyltransferase B; beta(1,6)-N-acetylglucosaminyltransferase V; glcNAc-T Vb; hGnTVb; mannoside acetylglucosaminyltransferase 5B; mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase, isoenzyme B; EC 2.4.1.155
• Gene ID: 146664
• mRNA Refseq: NM_001199172
• Protein Refseq: NP_001186101
• MIM: 612441
• UniProt ID: Q3V5L5