Recombinant Human MGST3 Protein, GST-tagged
Cat.No. : | MGST3-5311H |
Product Overview : | Human MGST3 full-length ORF ( AAH00505, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, several of which are involved the production of leukotrienes and prostaglandin E, important mediators of inflammation. This gene encodes an enzyme which catalyzes the conjugation of leukotriene A4 and reduced glutathione to produce leukotriene C4. This enzyme also demonstrates glutathione-dependent peroxidase activity towards lipid hydroperoxides. [provided by RefSeq |
Molecular Mass : | 42.46 kDa |
AA Sequence : | MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSIALLGLVGTTVCSAFQHLGWVKSGLGSGPKCCH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MGST3 microsomal glutathione S-transferase 3 [ Homo sapiens ] |
Official Symbol | MGST3 |
Synonyms | MGST3; microsomal glutathione S-transferase 3; GST III; microsomal glutathione S transferase III; microsomal GST 3; microsomal GST III; microsomal GST-3; microsomal GST-III; microsomal glutathione S-transferase III; GST-III; |
Gene ID | 4259 |
mRNA Refseq | NM_004528 |
Protein Refseq | NP_004519 |
MIM | 604564 |
UniProt ID | O14880 |
◆ Recombinant Proteins | ||
MGST3-2588R | Recombinant Rhesus Macaque MGST3 Protein, His (Fc)-Avi-tagged | +Inquiry |
MGST3-5311H | Recombinant Human MGST3 Protein, GST-tagged | +Inquiry |
RFL778MF | Recombinant Full Length Mouse Microsomal Glutathione S-Transferase 3(Mgst3) Protein, His-Tagged | +Inquiry |
MGST3-12599Z | Recombinant Zebrafish MGST3 | +Inquiry |
MGST3-5544M | Recombinant Mouse MGST3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MGST3-4326HCL | Recombinant Human MGST3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MGST3 Products
Required fields are marked with *
My Review for All MGST3 Products
Required fields are marked with *
0
Inquiry Basket