Recombinant Human MIA protein, His-tagged
| Cat.No. : | MIA-3470H |
| Product Overview : | Recombinant Human MIA protein(24-131 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | December 03, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 24-131 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | GGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | MIA melanoma inhibitory activity [ Homo sapiens ] |
| Official Symbol | MIA |
| Synonyms | MIA; melanoma inhibitory activity; melanoma-derived growth regulatory protein; CD RAP; CD-RAP; |
| Gene ID | 8190 |
| mRNA Refseq | NM_001202553 |
| Protein Refseq | NP_001189482 |
| MIM | 601340 |
| UniProt ID | Q16674 |
| ◆ Recombinant Proteins | ||
| MIA-3604H | Recombinant Human MIA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MIA-5001H | Recombinant Human MIA, His-tagged | +Inquiry |
| MIA-3333R | Recombinant Rat MIA Protein, His (Fc)-Avi-tagged | +Inquiry |
| MIA-5314H | Recombinant Human MIA Protein, GST-tagged | +Inquiry |
| Mia-874M | Recombinant Mouse Mia Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MIA-4325HCL | Recombinant Human MIA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MIA Products
Required fields are marked with *
My Review for All MIA Products
Required fields are marked with *
