Recombinant Human MIA protein, His-tagged
Cat.No. : | MIA-3470H |
Product Overview : | Recombinant Human MIA protein(24-131 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | August 04, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 24-131 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | GGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | MIA melanoma inhibitory activity [ Homo sapiens ] |
Official Symbol | MIA |
Synonyms | MIA; melanoma inhibitory activity; melanoma-derived growth regulatory protein; CD RAP; CD-RAP; |
Gene ID | 8190 |
mRNA Refseq | NM_001202553 |
Protein Refseq | NP_001189482 |
MIM | 601340 |
UniProt ID | Q16674 |
◆ Recombinant Proteins | ||
MIA-196H | Recombinant Human MIA protein | +Inquiry |
Mia-1543R | Recombinant Rat Mia protein, His & GST-tagged | +Inquiry |
MIA-3333R | Recombinant Rat MIA Protein, His (Fc)-Avi-tagged | +Inquiry |
MIA-2768R | Recombinant Rhesus monkey MIA Protein, His-tagged | +Inquiry |
MIA-400H | Recombinant Human melanoma inhibitory activity, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MIA-4325HCL | Recombinant Human MIA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MIA Products
Required fields are marked with *
My Review for All MIA Products
Required fields are marked with *