Recombinant Human MID1IP1 protein, GST-tagged

• Cat.No.: MID1IP1-876H
• Product Overview: Recombinant Human MID1IP1 protein(1-183 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-183 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGEEDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFGNWGH
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: MID1IP1 MID1 interacting protein 1 [ Homo sapiens (human) ]
• Official Symbol: MID1IP1
• Synonyms: MID1IP1; S14R; MIG12; THRSPL; G12-like; STRAIT11499; MID1 interacting protein 1; mid1-interacting protein 1; spot 14-R; spot 14-related protein; MID1 interacting G12-like protein; gastrulation specific G12 homolog; mid1-interacting G12-like protein; gastrulation-specific G12-like protein; MID1 interacting protein 1 (gastrulation specific G12-like)
• Gene ID: 58526
• mRNA Refseq: NM_001098790
• Protein Refseq: NP_001092260
• UniProt ID: Q9NPA3