Recombinant Human MID1IP1 protein, GST-tagged
| Cat.No. : | MID1IP1-876H |
| Product Overview : | Recombinant Human MID1IP1 protein(1-183 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | January 13, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-183 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGEEDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFGNWGH |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | MID1IP1 MID1 interacting protein 1 [ Homo sapiens (human) ] |
| Official Symbol | MID1IP1 |
| Synonyms | MID1IP1; S14R; MIG12; THRSPL; G12-like; STRAIT11499; MID1 interacting protein 1; mid1-interacting protein 1; spot 14-R; spot 14-related protein; MID1 interacting G12-like protein; gastrulation specific G12 homolog; mid1-interacting G12-like protein; gastrulation-specific G12-like protein; MID1 interacting protein 1 (gastrulation specific G12-like) |
| Gene ID | 58526 |
| mRNA Refseq | NM_001098790 |
| Protein Refseq | NP_001092260 |
| UniProt ID | Q9NPA3 |
| ◆ Recombinant Proteins | ||
| MID1IP1-876H | Recombinant Human MID1IP1 protein, GST-tagged | +Inquiry |
| MID1IP1-1629H | Recombinant Human MID1IP1 | +Inquiry |
| MID1IP1-7128C | Recombinant Chicken MID1IP1 | +Inquiry |
| MID1IP1-5760H | Recombinant Human MID1IP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MID1IP1-3475H | Recombinant Human MID1IP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MID1IP1-4320HCL | Recombinant Human MID1IP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MID1IP1 Products
Required fields are marked with *
My Review for All MID1IP1 Products
Required fields are marked with *
