Recombinant Human MID1IP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MID1IP1-4339H
• Product Overview: MID1IP1 MS Standard C13 and N15-labeled recombinant protein (NP_001092260) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: MID1IP1 (MID1 Interacting Protein 1) is a Protein Coding gene. Diseases associated with MID1IP1 include Gluten Allergy and Scoliosis. Among its related pathways are Import of palmitoyl-CoA into the mitochondrial matrix and Metabolism. Gene Ontology (GO) annotations related to this gene include protein C-terminus binding. An important paralog of this gene is THRSP.
• Molecular Mass: 20.2 kDa
• AA Sequence: MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGEEDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFGNWGHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MID1IP1 MID1 interacting protein 1 [ Homo sapiens (human) ]
• Official Symbol: MID1IP1
• Synonyms: MID1IP1; S14R; MIG12; THRSPL; G12-like; STRAIT11499; MID1 interacting protein 1; mid1-interacting protein 1; spot 14-R; spot 14-related protein; MID1 interacting G12-like protein; gastrulation specific G12 homolog; mid1-interacting G12-like protein; gastrulation-specific G12-like protein; MID1 interacting protein 1 (gastrulation specific G12-like)
• Gene ID: 58526
• mRNA Refseq: NM_001098790
• Protein Refseq: NP_001092260
• MIM: 300961
• UniProt ID: Q9NPA3