Recombinant Human MIF Protein, GST-tagged
| Cat.No. : | MIF-5337H |
| Product Overview : | Human MIF full-length ORF ( AAH00447.1, 1 a.a. - 115 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. [provided by RefSeq |
| Molecular Mass : | 38.39 kDa |
| AA Sequence : | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MIF macrophage migration inhibitory factor (glycosylation-inhibiting factor) [ Homo sapiens ] |
| Official Symbol | MIF |
| Synonyms | MIF; macrophage migration inhibitory factor (glycosylation-inhibiting factor); GLIF; macrophage migration inhibitory factor; GIF; L-dopachrome isomerase; L-dopachrome tautomerase; phenylpyruvate tautomerase; MMIF; |
| Gene ID | 4282 |
| mRNA Refseq | NM_002415 |
| Protein Refseq | NP_002406 |
| MIM | 153620 |
| UniProt ID | P14174 |
| ◆ Recombinant Proteins | ||
| Mif-648M | Recombinant Mouse Mif | +Inquiry |
| Mif-4001M | Recombinant Mouse Mif protein, His-tagged | +Inquiry |
| MIF-4551H | Recombinant Human MIF Protein (Met1-Ala115), C-His tagged | +Inquiry |
| MIF-4550H | Recombinant Human MIF Protein (Met1-Ala115), N-His tagged | +Inquiry |
| MIF-09H | Active Recombinant Human MIF | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MIF-1917HCL | Recombinant Human MIF cell lysate | +Inquiry |
| MIF-1884MCL | Recombinant Mouse MIF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MIF Products
Required fields are marked with *
My Review for All MIF Products
Required fields are marked with *
