Recombinant Human MIF Protein, GST-tagged

• Cat.No.: MIF-5337H
• Product Overview: Human MIF full-length ORF ( AAH00447.1, 1 a.a. - 115 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. [provided by RefSeq
• Molecular Mass: 38.39 kDa
• AA Sequence: MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MIF macrophage migration inhibitory factor (glycosylation-inhibiting factor) [ Homo sapiens ]
• Official Symbol: MIF
• Synonyms: MIF; macrophage migration inhibitory factor (glycosylation-inhibiting factor); GLIF; macrophage migration inhibitory factor; GIF; L-dopachrome isomerase; L-dopachrome tautomerase; phenylpyruvate tautomerase; MMIF
• Gene ID: 4282
• mRNA Refseq: NM_002415
• Protein Refseq: NP_002406
• MIM: 153620
• UniProt ID: P14174